Conserved Protein Domain Family
DUF3475

?
pfam11961: DUF3475 
Domain of unknown function (DUF3475)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 60 amino acids in length. This domain is found associated with pfam05003.
Statistics
?
PSSM-Id: 403245
View PSSM: pfam11961
Aligned: 48 rows
Threshold Bit Score: 63.6861
Threshold Setting Gi: 695006370
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q69TV7        35 ILSFEVANAMSRAANLYPlAVGRRGGAAARPRC-LGSQAVRALVPGDDSWLLALTLAEK 92  Japanese rice
VDD20382     138 ILAFEVANTIVKSSNLIE-SLSKENIMHLKETV-LYSQGVQNLVSNDFDELLRLVAADK 194 field mustard
XP_002300218 151 ILAFEVANTVVKGSNLMQ-SLSIRSVSYLKEEV-LPSEGVQNLISKDMDELLRIVAADK 207 black cottonwood
XP_009382151 173 ILSFEVASAMSRAVSLYR-SLSESEMARFRSQI-LASHGVRHLVSSDEHFLLSLALAEK 229 wild Malaysian banana
KRG90381      45 ILSFEVANVMSKTVHLHR-SLSESEISKLRNEI-LGSEGVRNLVSSDEGYLLELALAEK 101 soybean
XP_002885552  44 ILSFEVANIMSKTIHLHR-SLSDTEISKLKSEV-FRSEGVRNLVSSDENHLLDLAVSEK 100 Arabidopsis lyrata subsp. lyrata
XP_009102659  38 ILSFEVANVMSKTVHLHR-SLSDSDLSNLTSHV-FPSPGVSTLVSSDSNHLLDLAVSEK 94  field mustard
XP_006379876  56 ILSFEVANALSKTVHLYK-SLTDSEISKLKNEI-LKCEGVKNLVSNDESYLIQLALAEK 112 black cottonwood
CAN62136      43 ILSFEVANTMSKTVHLYK-SLTDHEISKLKTQI-LSSEGVKKLVSEDESCLLELALAEr 99  wine grape
XP_025826203  45 ILSFEVANAMSRAANLYR-SLSDAEAARLLGPLcLGSHAVRALVPGDDARLLALALAEK 102 Panicum hallii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap