Conserved Protein Domain Family
DUF3438

?
pfam11920: DUF3438 
Protein of unknown function (DUF3438)
This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 276 to 307 amino acids in length.
Statistics
?
PSSM-Id: 403209
View PSSM: pfam11920
Aligned: 17 rows
Threshold Bit Score: 373.626
Threshold Setting Gi: 407253286
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q888Z9              10 SALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDK--LRVQSTGGAIYLFAKDAIEPTR 87  Pseudomon...
Q1LKU9               7 ALLGLLAVAAAPVAQAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAGVGER--LRVQSAGGAVYLRASEPIEPTR 84  Cupriavid...
jgi:Tola_2441        7 VWLGMLACALVPMAHAVEILRWERLPLAVPLQVGEERIVFVDRNVRVGVPASVGDR--LRVQSAGGAVYLRASEPIEPTR 84  Tolumonas...
WP_014159649         7 TLGAALLLALSVPVHAVEILRWERLPLALPLVVGEERVIFIDRNVRVGVPASVGAR--LRVQSAAGAVYLRASEPIEPTR 84  Pseudoxan...
zhongguo:B5T_02119   6 LSALVATAAALTPAYAVEIHHWERKPIPVDLPVGEERIVLIDRNVRIGLPAELADPevLRVQSVGGALYLMAKNKFEAQR 85  Alcanivor...
jgi:HSM_1701         6 ILLVSLLIGFSGSSLADVLMKWERKPLPVALQVEKERIIFVDKNVKVGYPAELDGK--LRIQSTGGAVYLKALETFPSTR 83  Histophil...
Q7VMN8               5 ILFVGASLLLSNVASAEILLKWDRKPLPIELQVKEERIVFADKNVKVGYPAQLEGK--LRMQSSGGAVYFTALAEFPKSR 82  [Haemophi...
Q7N7N4              13 TALLFAGLVMVSPVEAVELMKWERIPLPVALHVGQERVVFVDKNVRVGFPGALDGK--LRIQSTGGAVYLYPSETFTQTR 90  Photorhab...
Q6D9P6              14 rglLAFLMTVSWHAAADELIKWERIPLQIPLKVGQERVIFADKNVRVGFPPALNDK--LRVQSTGGAVYLKADSAFPQTR 91  Pectobact...
CAX53331            18 lSLLPAIVMHSSQAHADELMKWERVPLQIPLKTGQERVIFVDKNVRVGFPPALNGK--LRVQSTGGAVYLKADGDFPQTR 95  Erwinia b...
Q888Z9              88 LQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGE-TSSARYGGAATARsAKATTKSMDSTSRSNDEDDEPEEvVKRE 166 Pseudomon...
Q1LKU9              85 LQLQDADTGALILLDIAAEPPKDGEAELEPVRIVEGD-SAPGRYG-----------EQADSAEAPARAQGQAGARtARRE 152 Cupriavid...
jgi:Tola_2441       85 LQLQDADSGALILLDIAAEPAKDGEPPLEPVRIVEGN-ATPQRYG--------------QAQESGTAAPSPDQARpPRRE 149 Tolumonas...
WP_014159649        85 LQLQDAGSGTVILLDIAAEAPQEGQPPLEPVRIVIAA----------------PAGGQGVAAEDDPQARAARTDR-PAPP 147 Pseudoxan...
zhongguo:B5T_02119  86 VQVQDIESGQIFLIDLAATEGARA----EDLRIVVSGdQSATSTADKKKSA-NEEGASSPDASNTP-------------- 146 Alcanivor...
jgi:HSM_1701        84 IEFRDVTTGEIFLFDLTAASKVAN--PEEAIRVVFDGtVEKQSFSSNRDDEsSDLPIANS-----------------RPQ 144 Histophil...
Q7VMN8              83 LQLVDLATGELILLDVEAKPHIPN--ANEPIRLVYTDkVEKQSTVFNQDSG-EEADLKNV-----------------KPQ 142 [Haemophi...
Q7N7N4              91 LQLQDVESGEVILLDVTATNG-KD--PLEPVRVVYHGdVITLTDDHQIHHG-AKGDNTSATSPSLAGERQAARRQkPSYT 166 Photorhab...
Q6D9P6              92 LQLQDLESGEIILLDVTASL--NG--PTEPIRLVYSGdVTTVDNSDRP----AKSSERSSSSSASETKLDAKAPKtPRYN 163 Pectobact...
CAX53331            96 LQLQDMESGEVILLDVRTTA--TA--SAEPVKIVYSGdVSTLNSATEGEGQ-K-SNADAGSQ-------QTKRKKv-SYK 161 Erwinia b...
Q888Z9             167 TPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKVERSLDLATLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQR-ITLD 245 Pseudomon...
Q1LKU9             153 TPVPVVLTRFAAQNLYAPLRTVEPLPGVMRVNLPRDLDLDTLMPTLPVRAVALASWRLEDQWVTAVRLTNTGADW-VALD 231 Cupriavid...
jgi:Tola_2441      150 TPVAVVLTRYAAQNLYAPLRTVEPVPGVMRVNLRRDLPLDTLLPTLPVRAEALAAWRLEDQWVTAVRLTHTGGGW-IDLD 228 Tolumonas...
WP_014159649       148 TPVPVVLTRYAAQSLYAPLRTVEPVPGITRANVRRDLPLHSLLPTLPIQAQALAAWRLGDLWVSAVRLRNTAPRG-FDLD 226 Pseudoxan...
zhongguo:B5T_02119 147 -PLPVRLTRYAAQTLYAPLRTVAPLPGVRRVPMRVSQTVP-LFWELPLQAQPLAAWRAGGLTVTAVEITNPDPNReFGLD 224 Alcanivor...
jgi:HSM_1701       145 LPVPAALTRYAAQSLYAPLRTVEPLDGVRRVAHRLPKKITKLLPAYSIEATPLISWQLDEYVVTAIRLQNKGNTQ-ITLD 223 Histophil...
Q7VMN8             143 LPVPAALTRYAAQMFYAPLRTVEPLEGVRQVAHRLPNKITTLLPAYPIQATPLLSWQLENFVVTAIRLQNRGSSH-IELD 221 [Haemophi...
Q7N7N4             167 APLPVVLTRYAAQSLYAPLRTVEAVPGIHPVSLALSPRLTTLYPSAPVIVSPLGGWGVDNLTVVALKVRNTHREN-VVLD 245 Photorhab...
Q6D9P6             164 APLPVVLTRFAAQTLYGPLRAVEPVSGIHPVNPRISGKITTLYPSEPFDITTLSAWGVGARSVVALRIRNTSSRK-VVLD 242 Pectobact...
CAX53331           162 APIPVLLTRYAAQNLYAPERTVEAVPGIHPVNPHLPSRITTLYPSAPVTVSPVAGWGVAGRTVVALRIRNSSSQK-VVLD 240 Erwinia b...
Q888Z9             246 PRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTRGHGLTQATVFsAAPADPRA 299 Pseudomonas syringae pv. tomato
Q1LKU9             232 PRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTGGRGLAQSLLP-AIHRFDPA 284 Cupriavidus metallidurans CH34
jgi:Tola_2441      229 PRALQGDFLTATFQHPTLGPRGTPEDTTVLYLVTRGRGLPQSLLP-AIHRFDPA 281 Tolumonas auensis DSM 9187
WP_014159649       227 PRALQGDFLTATFQHPDLGPAGTPEDTTVVYLVTRGRGLPQSLLP-AIAPVDas 279 Pseudoxanthomonas spadix
zhongguo:B5T_02119 225 PRRLQGEFVTATFMHPSVGPSTSEYAQTTVFLVTRGGGLEKALYPaAPKTQDTA 278 Alcanivorax dieselolei B5
jgi:HSM_1701       224 PRELQGQFYAATFQHNWLGGYGENEDTTTLYLVTEGYA-NNALIP-ETRPVKLV 275 Histophilus somni 2336
Q7VMN8             222 PRELQGRFYAATFQHGWLGGHGSPEDTTTLYLVTEGYA-NQALIP-ETHQYKTR 273 [Haemophilus] ducreyi
Q7N7N4             246 PRRLQGQFIAATFQHRWLGPSGTPEDTTTVYLVVKGRP-DRAFLP-EPVRSKTP 297 Photorhabdus laumondii subsp. laumo...
Q6D9P6             243 PRILQGQFVSATFQHRWVGPIGTPEDTTTLYLVTDSRP-ELAFFA-EPVAKMSS 294 Pectobacterium atrosepticum
CAX53331           241 PRELQGQFVTATFQHRWLGAAGTPEDTTTLYLVTSGRP-DEAFVR-EPSIVRKA 292 Erwinia billingiae Eb661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap