Conserved Protein Domain Family
Peptidase_S41_N

?
pfam11918: Peptidase_S41_N 
N-terminal domain of Peptidase_S41 in eukaryotic IRBP
Peptidase_S41_N is a family found at the N-terminus of the functional unit of interphotoreceptor retinoid binding proteins 3, IRBP, in eukaryotes. From the structure of Structure 1j7x, the domain forms the N-terminal end of the module which is characterized as a serine-peptidase, pfam03572. Peptidase_S41_N forms a three-helix bundle followed by a small beta strand and is termed domain A. Part of the peptidase domain folds back over domain A to create a largely hydrophobic cleft between the two domains. On binding of ligand domain A is structurally rearranged with respect to domain B.
Statistics
?
PSSM-Id: 403207
View PSSM: pfam11918
Aligned: 42 rows
Threshold Bit Score: 93.9053
Threshold Setting Gi: 1039378357
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P10745        309 AEQALEKALAILTLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASM----DFSTVVSEEDLVTKLNAGLQAASEDPR 384  human
XP_007233627  304 AEDALDAATEIIKLRAGIPATVKAAASLVSENYAFESIGEYVGQKLEALadsgEYKMISSRKELEEKLTADLAKLSADKC 383  Mexican tetra
XP_028917044  960 AAEALAVAQGIAALRSKVPTVLRTAAKLVADNYAFRETGAGVAAQMGGLq--aRCGRVTSEGALAEVLGAHLRALSGDPH 1037 platypus
XP_008528488  918 MSEALSTARDIVALRAKVPTVLQTAGKLVADNYASPELGAKVAAKLSRMq--sRYARVTSEGALAEMLEADLQMLSGDPH 995  Przewalski's ...
XP_001371866  919 SSEALMTTQGIVALRAKVPTILQTAGKLVADNYASLEVGSRVASKLAKLq--tQYRQVTSEGELADMLGADLQTLSGDRH 996  gray short-ta...
XP_003225437  914 sNEALASAQNIILFRTKLPSVLNTIGKLVADNYAFADIGATVAAKFADYakkgTYRKINSEIELSGKLAADLKALSGDRH 993  green anole
XP_005022274  916 ASEAMAVAQHIANLRAQVPQTLQTVGKLVAENYAFVDIGAVIASNLTKNinkgNYKRINSEEELARKVTANLQALSDDEH 995  mallard
XP_005992507  907 ASEAMAVAQCIINLRSKIPSIVQTAGKLVADNYAFADIGTDVASKIASLidkgNYSMINSEVELAEKLSADLQVLSGDKH 986  coelacanth
XP_002940687  899 ASEAMNVAHHIIKLRTKIPSVIQTAGKLVADNYAFADTGADVASKLIALvdkiNYKMIKSEVELAEKLNYDLQSLSKDVH 978  tropical claw...
XP_006630372  902 ANDAMSVALRIIDLRARIPSIVQAAGKLVADNYAFAHTGESAAEKLALLvhsrNYNVIDSEAELADKLTTDLQELTGDKN 981  spotted gar
P10745        385 LLVRAIgptetpswpaPDAAaEDSPGVAPELPEDEAIRQALVDSVFQVSVLP 436  human
XP_007233627  384 LKVR-----------------DNSPMMLPS-DISPEMLIELIKVSFQTDVFE 417  Mexican tetra
XP_028917044 1038 LQMVYI----------PEDAkDRIPGVVPMQIPSAETFEDLIKFSFHTSVME 1079 platypus
XP_008528488  996 LKTAHI----------PEDAkDRIPGIVPMQIPSPEAFEDLIKFSFHTNVLE 1037 Przewalski's horse
XP_001371866  997 LKTAHI----------PEDAkDRIPGIVPMQLPSPEAFEDLIKFSFHTNVFE 1038 gray short-tailed opossum
XP_003225437  994 LMISHI----------PERSkGRILGLVPMQIPPPEILEDLIKFSLHTNVFE 1035 green anole
XP_005022274  996 LKMLYI----------PEHAkDNIPGIMPKQIPSPEVFEDLIKFSFHTNVFE 1037 mallard
XP_005992507  987 LKTVHV----------PENSkDHIPGVVPMQIPSPEMFEDLIKFTFHTDVFE 1028 coelacanth
XP_002940687  979 LKAVYI----------PENSkDRIPGVVPMQIPSPEMFEDLIKFSFHTDVFE 1020 tropical clawed frog
XP_006630372  982 IKASYI----------PDHSkGTVPGLSPVQVLSPEMFEDLIKSSFHTDVFD 1023 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap