Conserved Protein Domain Family
Vac14_Fig4_bd

?
pfam11916: Vac14_Fig4_bd 
Vacuolar protein 14 C-terminal Fig4p binding
Vac14 is a scaffold for the Fab1 kinase complex, a complex that allows for the dynamic interconversion of PI3P and PI(3,5)P2p (phosphoinositide phosphate (PIP) lipids, that are generated transiently on the cytoplasmic face of selected intracellular membranes). This interconversion is regulated by at least five proteins in yeast: the lipid kinase Fab1p, lipid phosphatase Fig4p, the Fab1p activator Vac7p, the Fab1p inhibitor Atg18p, and Vac14p, a protein required for the activity of both Fab1p and Fig4p. The C-terminal region of Vac14 binds to Fig4p. The full length Vac14 in yeasts is likely to be a protein carrying a succession of HEAT repeats, most of which have now degenerated. This regulatory system is crucial for the proper functioning of the mammalian nervous system.
Statistics
?
PSSM-Id: 403206
View PSSM: pfam11916
Aligned: 75 rows
Threshold Bit Score: 173.063
Threshold Setting Gi: 154334393
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEC44390      443 LLETRGSLIIRKLCVLLNA-------KSVYIRMADTMas---------------------------yEMKD--------- 479  Phaeodactylum...
CCE42959      700 eksiKVEFIIRKLCLCLDS-------EIIFTTLSEVLqqhyhqqpstkqsgsqhhqsslyndkdanaQTES--------- 763  Candida parap...
EFC47090      481 LL-TKAGFIFRKLSVMLNP-------EKIFKELSNILl----------------------------dTKQS--------- 515  Naegleria gru...
EWS71066      484 kILNKSDIIIKQLCNILNP-------ELVFKTMASEL------------------------------RKYD--------- 517  Tetrahymena t...
A0DUT6        500 QSEKKGDQIFKKLCSLLNP-------QKVYFTITAKL--------------------------------LEiys-----d 535  Paramecium te...
A0EEU8        478 LLNRMSQIIIKKLCEFWNA-------EVVYTQICNKL--------------------------------LEnyvyvgddn 518  Paramecium te...
EDL47618     1075 LLIHKGKVIVQHITRCLNN-------KKFFAYLCYSL------------------------------IGEE--------- 1108 malaria paras...
Q7RCD2        294 LLIRKGKEIIQHVSRCLNN-------KKLFGYLCYFL------------------------------IYES--------- 327  Plasmodium yo...
XP_001563448  457 LLLRRFPDVVRRLHTLRSRlegedvrESVLVHFARAL------------------------------SDIT--------- 497  Leishmania br...
Q57WG8        452 VLLPKVPTIIKQLQLRYQEedl-gqcEKLCLKLADVV------------------------------SSHK--------- 491  Trypanosoma b...
EEC44390      480 -DgevadietLQFVSTMVQTLNLILLTASELQDLRTTL---ATAFIEssgarsnvfkevddddddDGGHVFATLFHCWAH 555  Phaeodactylum...
CCE42959      764 -N--------FEFANMLIVTLNNILLTSSELSPFRKKL---KNLDLSs----------------sKDWLLFATLFKSWCF 815  Candida parap...
EFC47090      516 -N--------MEFTSSLVQTLNMILLTSKELLGLRTSI---KKSHSSv-----------------EGQKLFHDLFKSWCH 566  Naegleria gru...
EWS71066      518 -D--------INFVSPFVRSLDLILLTDSDLKELRNFL---KNLQFQknl-------------vpEKIQLFVDIFKTWSY 572  Tetrahymena t...
A0DUT6        536 nD--------VLFISNTVQTLTTLLISEKELQNLRNIL---RNLKHEkdek-----------qrqHNQEIFETLYRTFCY 593  Paramecium te...
A0EEU8        519 lD--------LAFTQQLVQSLEYLLITEPRLQNIRMKL---KNYKYEknqk-----------takSTYEFFISIYKTFCY 576  Paramecium te...
EDL47618     1109 -N--------VPFVMKFIQVLSWVLLTSEETKYLRNALfl------------------------kKQYSLFSLILIAWLR 1155 malaria paras...
Q7RCD2        328 -D--------YIFVNKIVQVLNWILLTSNETKYLRNSLlfqK-----------------------DNYSLFSIILIAWLN 375  Plasmodium yo...
XP_001563448  498 -D--------LRFVSKVVLSLQSMLATFPELDDVRLLLr--RGLTNT------------------ATAEMFSALLQCWRY 548  Leishmania br...
Q57WG8        492 -D--------KRFVEKFVITLNTMLLTSRELLPLREVLh--RGVDDA------------------RAREAFLGLYNCFCY 542  Trypanosoma b...
EEC44390      556 NPIATFSLCLLARTYDLSFCLIKRFSDMpDVSVGFLMQIDKLVHLLESPIFLQLRLQLLDVESPchAPLLKSIYGLLMCL 635  Phaeodactylum...
CCE42959      816 NAPSAIALCLLTSNYELSYLLIKNLSEL-EVTSQLLTQLDVLIQLLESPIFVKLRLQLLEPENH--PFLYKTLYGILMVL 892  Candida parap...
EFC47090      567 NSIATLTLCLLANQYKLASYLVSSFTEI-EVTVEFLTQIDNLVQLLESPIFVDLRLQLLEPHKH--PYLLKTLYGLMMLL 643  Naegleria gru...
EWS71066      573 NPVSAITLCFLTQAYELAYNIIMSFCEI-ELNKSNLTQICELIYLLEKPIFVYLRLQLLEHEKY--PYLLKSLHGLMMLL 649  Tetrahymena t...
A0DUT6        594 NSMSVITLCLLSEEYELAYNIIISFSEV-EVNQYILLEIAQLINVLETPVFIFLRLQLLEYDSH--PFLMKCLFGLMMLL 670  Paramecium te...
A0EEU8        577 NEVSALSLSLLIEEYELTYNIILTIAEQ-ETNVEILVQIARLTLLLESPVFAYLRLQLLESANH--PFLIQSLQGLMMLL 653  Paramecium te...
EDL47618     1156 NPISSISFLLWLEKYQLAYLICSYLSLL-SLNSDFYHQLDNLIFLLESPIFSKQRMHLVYPQNY--PFLIKSLMILSLML 1232 malaria paras...
Q7RCD2        376 NSLCAISFLLWLQKYELAYFICSYLTLL-DINSDFFHQLDNFIFLFESPVFSKQRLHLIYPKNY--PFLIKSLMILSLML 452  Plasmodium yo...
XP_001563448  549 NAVALLSLGLLCRHFVFTRRICEHLGEG-EMSVATYVQLDHLVQQLESSTFTFLRVSLLRPMSC--PALVQTLYVLLLLL 625  Leishmania br...
Q57WG8        543 NTVSALSLCFLSRAYEHAYQLVRFMGSC-EMSANTLVQLERLVRLIETPALSYVRIALMEPSKC--LPLVRTLFAMQLIL 619  Trypanosoma b...
EEC44390      636 P-QGNAFRLLNERLATV 651  Phaeodactylum tricornutum CCAP 1055/1
CCE42959      893 P-QSSTFMTLRNRLSVc 908  Candida parapsilosis
EFC47090      644 P-QTTAFTKLSKRLECV 659  Naegleria gruberi
EWS71066      650 P-QGETYNLLASRIKLV 665  Tetrahymena thermophila SB210
A0DUT6        671 P-QGPAFNMLRQRLKNV 686  Paramecium tetraurelia
A0EEU8        654 P-QSPIQKYLKSRLKNI 669  Paramecium tetraurelia
EDL47618     1233 P-LNTSNNILQKRLQMS 1248 malaria parasite P. vivax
Q7RCD2        453 P-LNTSNNILQKRLQIS 468  Plasmodium yoelii yoelii
XP_001563448  626 PqSSPHYATLSRRLQPV 642  Leishmania braziliensis MHOM/BR/75/M2904
Q57WG8        620 PqCSPQYMILYRRIKTI 636  Trypanosoma brucei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap