6NBQ


Conserved Protein Domain Family
NdhN

?
pfam11909: NdhN 
Click on image for an interactive view with Cn3D
NADH-quinone oxidoreductase cyanobacterial subunit N
The proton-pumping NADH:ubiquinone oxidoreductase catalyzes the electron transfer from NADH to ubiquinone linked with proton translocation across the membrane. It is the largest, most complex and least understood of the respiratory chain enzymes and is referred to as Complex I. The subunit composition of the enzyme varies between groups of organisms. Complex I originating from mammalian mitochondria contains 45 different proteins, whereas in bacteria, the corresponding complex NDH-1 consists of 14 different polypeptides. homologs of these 14 proteins are found among subunits of the mitochondrial complex I, and therefore bacterial NDH-1 might be considered a model proton-pumping NADH dehydrogenase with a minimal set of subunits. Escherichia coli NDH-1 readily disintegrates into 3 subcomplexes: a water-soluble NADH dehydrogenase fragment (NuoE, -F, and -G),the connecting fragment (NuoB, -C, -D, and -I), and the membrane fragment (NuoA, -H, -J, -K, -L, -M, -N). In cyanobacteria and their descendants, the chloroplasts of green plants, the subunit composition of NDH-1 remains obscure. The genes for eleven subunits NdhA-NdhK, homologous to the NuoA-NuoD and NuoH-NuoN of the E. coli complex, have been found in the genome of Synechocystis sp. PCC 6803 which has a family of 6 ndhD genes and a family of 3 ndhF genes. Two reported multisubunit complexes, NDH-1L and NDH-1M, represent distinct NDH-1 complexes in the thylakoid membrane of Synechocystis 6803 -cyanobacterium. NDH-1L was shown to be essential for photoheterotrophic cell growth, whereas expression of NDH-1M was a prerequisite for CO2 uptake and played an important role in growth of cells at low CO2. Here we report the subunit composition of these two complexes. Fifteen proteins were discovered in NDH-1L including NdhL, a new component of the membrane fragment, and Ssl1690 (designated as NdhO), a novel peripheral subunit. The cyanobacterial NDH-1 complex contains additional subunits, NdhM and NdhN, compared with the minimal set of the bacterial enzyme and these seem to be specific for thylakoid-located NDH-1 of photosynthetic organisms.
Statistics
?
PSSM-Id: 403200
View PSSM: pfam11909
Aligned: 43 rows
Threshold Bit Score: 223.646
Threshold Setting Gi: 123500993
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6NBQ_N           3 LLAGYQFVKDLESAGALALFVPPEGGFEGRYQRRLRSKGYTTLPMSAPGLGDLAAYLTQEHGIRPAHTGKEDI------- 75  Thermosynecho...
WP_015170847     4 LTTGRQFIKNLEQAGALGVYAPLEGGAEGRYRRRVRAAGYSMVQLTSRGLGDPASFLMGIHGVRPPHLGKKEI------- 76  Geitlerinema ...
Q31L05           4 ITTGSKFLRALEQEGALAVYAPLEGGYEGRYLRRLRSKGYSALTYSARGLGDPAQFLMDIHGVRPPHLGKQTIgneaavg 83  Synechococcus...
A5GVV9           4 LLTGRAFRRDLERERALAVYAPLEGGAETRLLRRLRAAGYRTELTSARGLGDPEAFLLGLHGVRPPHLGHHCVgrdaavg 83  Synechococcus...
jgi:Cyagr_1810   1 -mTGRGFRTELERCGALALFVPLEGGAETRLLRRLRAAGYRAHLTSARGLGDPEAYLMQLHGIRPPHLGHHSVgraaavg 79  Cyanobium gra...
Q7V543           4 LLSGRVFRRDLDACGCLAMHVPLEGGSETRLLRRLRAAGYRTQLSSARGLGDPEVFLFELHGIRPPHLGHQSVgrngavg 83  Prochlorococc...
Q7V9W1           4 LLSGRKFRHDLEASGCLAINVPLEGGAETRLLRRLKAAGYKTQITSVRGLGDPEAFLLKLHGIRPPHLGHQNVgrngalg 83  Prochlorococc...
A5GIU6           4 LLSGRGFRRELESAGCMAVHAPLEGGAETRLLRRLRAAGYRTHLTSARGLGDPEVFLFQKHGVRPPHLGHQSVgrgaavg 83  Synechococcus...
XP_002968095    11 rfdrGKFYKDVEKFGSIAIYPPPEGGYEGRYANKLQMEGYHIMAMSAKGLGDLESYLTKVHGVRPPHLGKQAI------- 83  Selaginella m...
XP_002532930    73 kfdleQWLSDVEEHKALAIYTPHEGGYEGRYFTRLRYQGYYFLDLTARGLGDPETTLTKIHPVCPAHVGKQPI------- 145 castor bean
6NBQ_N          76 RVYFQPPLVTYHLENLPPNAKGLVLWLIDGKRLSKQEFAYLAQLTQTLPKFKVVVEVGGDRVVRWEPLAD 145 Thermosynechococcus elo...
WP_015170847    77 RTQYILPLLEYHLEHLPANTKGLVLWLLEGTVLSRQELEYLISLTQQNPKLKVVVEMGGDRTFKWKSLQD 146 Geitlerinema sp. PCC 7407
Q31L05          84 RVEYVLPLVGYPLQNLPANAKGLVLWLLEGHVLSPQELSYFVTLPQAEPRLKVVIEMGGDRGFSWQPLAA 153 Synechococcus elongatus...
A5GVV9          84 EVQLVMPQLGPALA----SGAPVVLWMLEGQVLSSAEQASLLALCEREPRLHMVLELGGSRSLRWKPLRA 149 Synechococcus sp. RCC307
jgi:Cyagr_1810  80 EVQRVMPQLGPALA----GDGPVLLWLLEGQVLSSSELAALCELCRREPRLKLVVEMGGARALRWQPLEQ 145 Cyanobium gracile PCC 6307
Q7V543          84 EVQQVMPQLAELFV----DNAPVVLWLLEGQVLSRSELLALCDLCKRESRLRVVVEMGGARSLNWQPMST 149 Prochlorococcus marinus...
Q7V9W1          84 EVQQVIPQVNELLA----GEKSVVLWLLEGQVLSRSEILSLCDLCDKEPRLKIVIEMGGARALRWQSMRS 149 Prochlorococcus marinus...
A5GIU6          84 EVHDVMPLLGEVFL----GDKPVVLWLLEGQVLSRSELLSLCDLCRREPRLKIVVEMGGARSLRWQPMTQ 149 Synechococcus sp. WH 7803
XP_002968095    84 SVWYFPPEIDYRLSMLPEDCKGLVLWLLECEVLSKAELQFLTLLPALRPKVRVIAECGGWRKFVWTPLKN 153 Selaginella moellendorffii
XP_002532930   146 ARWYFPPEVDYRLAALPPDAKGLVVWIIEAKVLSKAELQFLALLPSLRPKVRVIAECGNWRKVMWKPLKE 215 castor bean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap