Conserved Protein Domain Family
DUF3425

?
pfam11905: DUF3425 
Domain of unknown function (DUF3425)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 120 to 143 amino acids in length.
Statistics
?
PSSM-Id: 403197
View PSSM: pfam11905
Aligned: 34 rows
Threshold Bit Score: 67.0505
Threshold Setting Gi: 388853754
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCF52475     615 DDFPRFPGDSSSGATELyLPKNLMPTEMQM-----RIGfHPVEIAVLPYPAMRDRVLTilsAFQA--IEElaqeeedaar 687 Ustilago hordei
ERT01316     477 YHYVKWRMQPSAARYAM-LPTFLQPLHEQV-----WVP-HPGSLDFVIWEGPRRKLLK---TYDRy--DV---------- 534 Sporothrix sche...
Q2UV05       267 YSFVKWRANPSPLAYAN-MPNFIQPVAGQV-----RQD-QHADLVFFLWPQLRLNVLE---NWNTi--DI---------- 324 Aspergillus oryzae
EED14378     295 YNYSKWRASPTPATFAR-LVPFQHPTPLQL-----EQD-HFGGIDMMIWPKMRENMIR---RWHEl--DF---------- 352 Talaromyces sti...
XP_007295752 418 YHFCQWQILPDVNTYSS-MPERFRPRPSQM-----STA-HPIWTTLLAWGRMRDVVIS-----NQekYAT---------- 475 Marssonina brun...
XP_001241998 434 FLLMRWQIYPTRENYDR-LPEWITPRVSQL-----VTP-HPPWMDYLPWPRMRDRMIA-----CHtdYDF---------- 491 Coccidioides im...
EGR47952     487 FLFMRWQISPTKENLER-LPEWIRPLPCQF-----EVP-HAAWMDFLPYPEMRERVIK---ANNPevFYF---------- 546 Trichoderma ree...
CBX94937     315 fkLLKYYLKATKEELDK-VPKWLQPSHGQS-----ATK-HPVAIDFFAWPSLRDRLIA----YQEtfFQD---------- 373 Leptosphaeria m...
XP_001387909 371 SSISQYHISSPRVPVL--FPGFFKPTALQEyylenNIP-YKHLINFIVWPEFRDALLR---NADQmeFSGs--------- 435 Scheffersomyces...
Q0UBL6       350 EAIMQWRLAPTEDNVEK-IPEPFRPTPLQR-----NLA-HSSVIDMLNWAHLRDRLILl--SNQDrtLDI---------- 410 Parastagonospor...
CCF52475     688 fseqhassdnteqqeqqqgqqqqqqqqqqsqqyqpssndqdteltdadihqrtamvadmsawkpkdfsgavvmpdkgrvy 767 Ustilago hordei
ERT01316         --------------------------------------------------------------------------------     Sporothrix sche...
Q2UV05           --------------------------------------------------------------------------------     Aspergillus oryzae
EED14378         --------------------------------------------------------------------------------     Talaromyces sti...
XP_007295752     --------------------------------------------------------------------------------     Marssonina brun...
XP_001241998     --------------------------------------------------------------------------------     Coccidioides im...
EGR47952         --------------------------------------------------------------------------------     Trichoderma ree...
CBX94937         --------------------------------------------------------------------------------     Leptosphaeria m...
XP_001387909     --------------------------------------------------------------------------------     Scheffersomyces...
Q0UBL6           --------------------------------------------------------------------------------     Parastagonospor...
CCF52475     768 sygflekprgshrlrkpaqrwlDDFFYEV--------------VK----------------------------------- 798 Ustilago hordei
ERT01316     535 ----------------------VKFIRRY--------------CRc---------------------------------- 544 Sporothrix sche...
Q2UV05       325 ----------------------IELYRYA--------------ISa---------------------------------- 334 Aspergillus oryzae
EED14378     353 ----------------------VEVFDFL--------------SCc---------------------------------- 362 Talaromyces sti...
XP_007295752 476 ----------------------AEFMELY--------------NAs---------------------------------- 485 Marssonina brun...
XP_001241998 492 ----------------------SNWFIPY--------------TTt---------------------------------- 501 Coccidioides im...
EGR47952     547 ----------------------DNFFLPF--------------TSt---------------------------------- 556 Trichoderma ree...
CBX94937     374 ----------------------SEFSRCY--------------VDy---------------------------------- 383 Leptosphaeria m...
XP_001387909 436 ---------------------mDEVMDNV--------------------------------------------------- 443 Scheffersomyces...
Q0UBL6       411 ----------------------DQAVRDIllhtvfevphlnlsLStldayyntigrqqglpplsqhdilrkiegvasiip 468 Parastagonospor...
CCF52475     799 ------TLRVWS----------------------------------------------PAgdVFDGECFEFKESFFRKYP 826 Ustilago hordei
ERT01316     545 ------LRLRWRreedvlvtnve-------------------------gkhvlrpdfvER--FMSTAGWGLDPEFVKYYP 591 Sporothrix sche...
Q2UV05       335 ------CRVRWPssqsiwdwddn-------------------------nnmfvkpeffQT--FMDRSGWGLTSVFIDKYP 381 Aspergillus oryzae
EED14378     363 ------MKVRWPwnkdmlerdae-------------------------dnlqiredfrQI--FSREDGWGLTAEFIDRYP 409 Talaromyces sti...
XP_007295752 486 ------VNVNWPygeenilmfvg-------------------------eevmateafiQH--IETEANFSLDEPFQQRYP 532 Marssonina brun...
XP_001241998 502 ------LSINWPysdsdaliaipn-----------------------seeyvinpvfeSH--LRNLNNWSLGPAFAKHYP 550 Coccidioides im...
EGR47952     557 ------LTLSWPyeeahtllrnpd-----------------------sdeiminpvfeSH--MRNLNNWKLGRIFAESFP 605 Trichoderma ree...
CBX94937     384 ------VQFDWPfpfedaffqdea-----------------------tgtyypsplfeRY--HNDLQYWTVDPKFSEKFP 432 Leptosphaeria m...
XP_001387909 444 -----------VirmtqslqpeklffvqqlkdvitlemqqrmegvslnmvpnissaelVNagITNPNNWKLTRSYGFRYS 512 Scheffersomyces...
Q0UBL6       469 etgcnhTAQYWFeivremsttmqdldvq---------------qtpryqlaeshfaqkLG--VTRLSGWKLSRKWWEDYA 531 Parastagonospor...
CCF52475     827 YMVDG---EIL 834 Ustilago hordei
ERT01316     592 ELFDGdewDQI 602 Sporothrix schenckii ATCC 58251
Q2UV05       382 QLMKGmdvEHI 392 Aspergillus oryzae
EED14378     410 MLLEGmdlEAL 420 Talaromyces stipitatus ATCC 10500
XP_007295752 533 ELRNAcrfTEL 543 Marssonina brunnea f. sp. 'multigermtubi' MB_m1
XP_001241998 551 DLVDTcriKTD 561 Coccidioides immitis RS
EGR47952     606 MLADTcqyHDa 616 Trichoderma reesei QM6a
CBX94937     433 EVVGDidvDRr 443 Leptosphaeria maculans JN3
XP_001387909 513 KVVPSn-lIVE 522 Scheffersomyces stipitis CBS 6054
Q0UBL6       532 YLATQhgqCDA 542 Parastagonospora nodorum SN15
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap