5MH2


Conserved Protein Domain Family
DUF3421

?
pfam11901: DUF3421 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3421)
This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 119 to 296 amino acids in length.
Statistics
?
PSSM-Id: 403194
View PSSM: pfam11901
Aligned: 127 rows
Threshold Bit Score: 89.9142
Threshold Setting Gi: 443921335
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5MH2_A               23 INKKALFIARAVVSGEMTPGKCGTHLegAHIPFAGKEHIIQ--NYEVLVypINalgfLDWQQASNGDVP------GNAId 94  Pacific ...
WGS:AANI:GJ12817-PA  50 SYGYDNYVARVPYASSIVPARVRSET--GYATFNTQAVANQatSYELLV--ANetvsYHWVRSYDGFRErnavsvGTSD- 124 Drosophi...
XP_001988120         52 PAGYRNYVGRTLYSASVVPARIRAET--GYVTFNTESVANTatFYEVLV--SNatlsYHWVHSFDGFREdnavcvGTSS- 126 Drosophi...
EDW02984             52 PEGYRSFVGRVLYLTSVVPARIRAET--AYVTFNTESVANTatFYEVLV--SNatlsYQWVHSFDGFMEdnavcvGTSS- 126 Drosophi...
EDW02983             52 PEGYRSFVGRVLYAGSVVPARIRAET--AYVTFNTDSVANTatSYEVLV--SNetlsYQWVRSFDGFMEdnavsvGTSS- 126 Drosophi...
WGS:AAPP:GF25227-PA  52 PDGYYNYVGRAVYSSSILPARVVPEL--GKATFNTETLSNQatSFEVLV--ANetisYHWKRSFDGYREedavsvGTNS- 126 Drosophi...
Q9VVM3               69 PDGYYTYVGRVTYSSNILPARVVPEL--GKATYNTDTLGNQatTYEVLV--SNatvgYHWIRSFDGFREknavsvGTNA- 143 fruit fly
XP_002135152         52 SEGYYNYVGRVVYSSNILPARVVPEL--NKASYNTDTIGSQtkAYEVLV--SNatvrYHWQHSFDGFLEksavsvGTDA- 126 Drosophi...
Q2LZ12               56 PEGYYNYVGRVVYSSNVLPARVVPEL--SKASYNTDTLSNTatSYEVLV--SNatvsYRWKRSFDGFLEkravpvGTNS- 130 Drosophi...
WGS:AAQB:GK20577-PA  52 SDGYYNYVGRVLYSSAVLPARVVPEL--SKATYNTETLGNVaaTYEVLV--ANetvsYEWIRSYDGYREknavsvGTDA- 126 Drosophi...
5MH2_A               95 TASGIYIGRVLYSGSLIPCKIHTGFKVAYMGFAGKEHQS 133 Pacific oyster
WGS:AANI:GJ12817-PA 125 LNERVYVCRARTDGGIFIGTLYLAQKVCFIRYENFPMRQ 163 Drosophila virilis
XP_001988120        127 TDERVYICRAKTDGGLLIGTLYPDIRTCIIRYENLPLRK 165 Drosophila grimshawi
EDW02984            127 SDERVYICRAKTDGGLFIGTLYLAQRTCIIGYENLPLRK 165 Drosophila grimshawi
EDW02983            127 TNERVYICRARTYDAVFIGTLYLAQRKCNIRYESIPPKM 165 Drosophila grimshawi
WGS:AAPP:GF25227-PA 127 VNDRVFICRARSDSAVIIGTLILAQRSCIIKYESLPIRY 165 Drosophila ananassae
Q9VVM3              144 LSERVFICRVRCDESIFIGTLYLSKRMCIVKYDNFPLRQ 182 fruit fly
XP_002135152        127 SNDRVYICRFRTDEGLLVGTLLLGKRVCIVKIDEKPLRT 165 Drosophila pseudoobscura
Q2LZ12              131 FGDRVYICRFRADEGLFIGTLYLGKRVCIVKYGENPLRQ 169 Drosophila pseudoobscura
WGS:AAQB:GK20577-PA 127 TNNRVFICRAISDQGLFIGTLYLAKRACIIKYESYPLRT 165 Drosophila willistoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap