Conserved Protein Domain Family
DUF3375

?
pfam11855: DUF3375 
Protein of unknown function (DUF3375)
This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 479 to 499 amino acids in length.
Statistics
?
PSSM-Id: 403152
View PSSM: pfam11855
Aligned: 68 rows
Threshold Bit Score: 252.95
Threshold Setting Gi: 490389301
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8G6E6              12 RPVYETGVLRLLLRQNAMLYVSLLRSTFDPLTGELPRETVEERFAQSLSSLAdageyapredqtfaeA---------AHQ 82  Bifidobac...
jgi:Jden_1567       12 RSAFDQPTLALLNRHYAPTVLTILAQVFPPHRASVDAEQVALEVEQHRLALAh--------------HncddldghsVRQ 77  Jonesia d...
jgi:Isova_2001      19 eRAFAAPTLGLLHKAEAPLVVAVLRSVFTPDRRAVATEQLHVEVDDLLAELRaaag-------rgeaPvqvpvpdepARV 91  Isopteric...
WP_012878982        12 vRAFRSPMLALLHKRDAPLVVALLSSVFRPDRRTVQVADAHTEMDDALAQLRaaghdd--------------vsdrsARE 77  Xylanimon...
WP_013583248        14 vtAFKNPTLDLLHGRFAPFVVAVLSIVFTPDRPAVAVADAHVEVAEAIDELRaag---------ydtDddrripagsARD 84  Microbact...
CeBiTec:CVAR_1975   14 SAAFRNPTLDLLHGRYAPFVIAALSLVFTAERPTVTVADAHVEVGDIAEALRasgeen--------------lpvgtGRE 79  Corynebac...
CeBiTec:CGLY_05555  14 aAAFKNPTLDLLHGRYAPFVVAALSLIFTPDRPTVAISDAHVEVGDVVEELRaagy-------deddRgsrglpsgnGRE 86  Corynebac...
WP_013770914        13 LRAFQNPMLDLLHKRHAPLVVALLSSVFTAERPTVPVADAHTEIGDALDQLRaagyed-------------glpvgpARD 79  Cellulomo...
jgi:Cfla_2029       13 vRAFRNPMLDLLHKRHAPLVVALLSLVFTSERPTVPVADAHTEVGDALEQLRaaghgd-------------dlpvggPRD 79  Cellulomo...
WP_012085416        12 QQAFARPTLELLRRPSGPLVVAVLTCVFAGQRTRVPADRLHSQVHGLLGELAlhghe---------------vpdvpARD 76  Kineococc...
Q8G6E6              83 ILADLTREGegdyaWLANSHDAAS--------HRFLYRLTARAHRAIEALSRLEDESRALSGAQANSIIMEIEHARMQLT 154 Bifidobac...
jgi:Jden_1567       78 LLSRWVREK-----WLIRHLADD---------GTELFTLTSHTKDALDFVHRASGAHPLVSSTRMRTLIDTLDRFAHEAQ 143 Jonesia d...
jgi:Isova_2001      92 LCTRWVRER-----WLVRSLDDD---------GGERYQVSSYAAEALDVVARTQGTRALVSESRIRTLLVALEDLARDAR 157 Isopteric...
WP_012878982        78 LCRTWVDAG-----WLVRQVDDASreagvpreGAEVYRLSAHAVDALEVASRAGGGHARVSRSRVLTLLEAVERLADDAD 152 Xylanimon...
WP_013583248        85 ICRGWVRVG-----WLGLQIEDD----------VEVYRLSAHAVGALEIAGRAGGGRARVSRSRVRTLLDAVDRLARDAE 149 Microbact...
CeBiTec:CVAR_1975   80 ICRYWVRVG-----WLVPHIDDSSg------tGTEVYRLSAQAVSALEIAGRA-GGRVRVSRSRMRTLLDSIDQLVSDSE 147 Corynebac...
CeBiTec:CGLY_05555  87 ICRYWVRVG-----WLVPQIEDD----------VEVYRLSAQAVGALEIVGRSGLGRARVSRSRVRTLLDAVEHLAHEAE 151 Corynebac...
WP_013770914        80 LCRQWADAG-----WLVRQVLDD---------DVEAYRLSAHAVGALEVAGRAGGTGARVSKSRVRTLLEAVDRLAQDAD 145 Cellulomo...
jgi:Cfla_2029       80 LCRQWADAG-----WLVRQVVED---------DVEVYRLSAHAVGALEVAGRAGGARARVSQSRVRTLLEAVERLALDAD 145 Cellulomo...
WP_012085416        77 LCRGWVARQ-----WLSLAASGEE--------GEEEYALTSHAQDAVEYVARLSGPRVLLGESRIRTILDTARRCATGAR 143 Kineococc...
Q8G6E6             155 ADPGERIKLLNREIKERKHEIKRIQQgKQHATLSEAQVEDVIAVIHNTLRGVPIDLRELVLDERDNGDALRRRMQAGDIS 234 Bifidobac...
jgi:Jden_1567      144 PDRDQRIARIDHDIAQLSRERDELAAgAPMPTMSVQRMVENLDNVRHLVRELPADFARVAESMKDLQRHILTQLRAGDRR 223 Jonesia d...
jgi:Isova_2001     158 PDREARMRELRAQIDEAEAELARLEAgGDVEPVAPERLAERYDNLLWLVRELPTDVARVAESISALQREIVARLRQDERA 237 Isopteric...
WP_012878982       153 PDVMTRMLRLQREITVRQAELDRLDRtGEIDPVDEEQLLEAAENVLLLVRELPADFARVAESIRAIQRETVTALRQDARP 232 Xylanimon...
WP_013583248       150 SDPVRRREALLEERAALDAEIAALDD-GIVEPLDDDHLLEEAENVIHLARELPADFSRVAESIAAMQRDVVAELRRDVRP 228 Microbact...
CeBiTec:CVAR_1975  148 TDPETRRATLLAERDALDAQLSRLEA-GEVEPVDDDQLLEEAENVLHLSRELPADFVRVAESINEMQRDVVADLRRDVRP 226 Corynebac...
CeBiTec:CGLY_05555 152 TDPQERIATLRAERAAIDEEIDKLER-GEVDPVDDDQLLEEAENVVHLSRELPADFARVAESINAMQRDVVADLRRDVRP 230 Corynebac...
WP_013770914       146 PDVMVRVARLDAQVRELQAELERLERtGTVDEVDEEELLEEAENVLHLVRELPGDFARVAESIKAMQRDVVTALRQDERP 225 Cellulomo...
jgi:Cfla_2029      146 PDVMVRIARLDTEVKRLQAEIARLERtGVVEEVDDEELLEEAENVLHLVRELPADFARVAESIKAMQRDVVTALRQDQRP 225 Cellulomo...
WP_012085416       144 ADREWRLQRLEEEIASLSAERDRLLAgGEVEEASDEQMLGEYLNLQDLLSALPGDFLRVSEEVRRLHREIVSDFRAEQRP 223 Kineococc...
Q8G6E6             235 VDENLTRYHDEYRRSFReSDSGRRFEDAFQVIITDEGRQQIDEALRAIAKTPYLAgESGVLLGQIRDELARIYDGIEAVR 314 Bifidobac...
jgi:Jden_1567      224 AGDVLDDYLDQAQHLLTaTPEGRAFTGALDILRDDATVAALNHAIHTIVSSPAGQsLPFAEKEALRSIVSSIVDSVDVVL 303 Jonesia d...
jgi:Isova_2001     238 TGVVVAEYLDASENLLErTAEGRAFAGAMELLGDARMLDALDERVQAVLSHPFAAdLPAERRAALRALRARLVSAIEVVL 317 Isopteric...
WP_012878982       233 TGEVLQDYLERAEHLMDaTAEGRAFSGAKRLLDDPERMDALVDGLDTVLRHPFAHrLPEHQRAELRAVALRIEAGFAEVL 312 Xylanimon...
WP_013583248       229 TGEVLREYLERGRQVMQaTPEGRAFQGALRLIGDPENIDDLTDQLHAVLAQPFSRlMTPEQRGELDAIARRVEAGVQEVL 308 Microbact...
CeBiTec:CVAR_1975  227 AGEVLREYLHRGQHVMDaTPEGRAFAGALELIGEPEHIDRLTDQLQNLLAQPFARhLPVTQQHDLAAVAHRVEQGVTEVL 306 Corynebac...
CeBiTec:CGLY_05555 231 TGEVLREYLHRGQHVMEaTPEGRAFSGALNLIGDPENIDHLTDQLSMLMALPFSRhMSADQRRELLAIARRVEQGVQEVL 310 Corynebac...
WP_013770914       226 TGDVLREYLERGEHVMEsTAEGRAFAGALRLIGDPHRLDGLSTQLGLVLRHRFTRrLTPQQRTDLREVGRRIEQGLDQVF 305 Cellulomo...
jgi:Cfla_2029      226 TGDVLREYLRRGEQVMDaTPEGRAFAGALRLLGDPQRLDELATQLDTVLRHRFSArLPAAQRTELREVVRRIEQGLDQVF 305 Cellulomo...
WP_012085416       224 SGEVLDDYLRRSEEVLTgSLSGRAFAGAVDLVRDEVTSRELHADIATILGHGFAGeLPAEQAATLERTMQTLVEGIEVVL 303 Kineococc...
Q8G6E6             315 RQMRVSDEAISRLVRQQTDTRYRTMLTRLNRLYARLNADAKTHMGDASRPYDTATSDAlFAPLPM----RPAKsmtrata 390 Bifidobac...
jgi:Jden_1567      304 SEQQRASRSLTTHLRHYNPAHDREIDDALEHALSALTRWFPS----TSRGERVPALPRfRRAHIGklrtTVPDirpaqgp 379 Jonesia d...
jgi:Isova_2001     318 AAQARASRTVTAQIRHHNPLRDRELDTALREATAAMAEWFPA----SGRAARVEPLRWfERARLGrlrdSLHDlrpetpp 393 Isopteric...
WP_012878982       313 TAQRIASRVITTQVRHHDPLRDRQVDELLRDVVAALGAWMPT----SRRAQPVEALRRlPRARVGrvrtTLADltprrgp 388 Xylanimon...
WP_013583248       309 TAQRRASHVITAQVRTHDPIRDRQVDDLLRGVMAGLHRWSQT-----RAPGRVEPVRTlPLADVGhlrqSISDirpagap 383 Microbact...
CeBiTec:CVAR_1975  307 TAQRRASHVITAQVRTHDPVRDREVDDLLRTVMSGLQSWMPQ----SSRGDRVDPLRSfPAAKVGalrrNLNDlqpesap 382 Corynebac...
CeBiTec:CGLY_05555 311 TAQRRASHVITAQVRTHDPVRDREVDDLLRNVMSGLQTWMQETAADARAHDAVAPLRSfPTAHLGhlrqTLNDlhppgap 390 Corynebac...
WP_013770914       306 TAQREASYVITTQVRNHDPLRDRQVDDLLRDVMTGLQSWMPL----ARRGQAVEPLRRlPVAEVEhlrqSAGDlrppepp 381 Cellulomo...
jgi:Cfla_2029      306 AAQREASYVITGQVRHHDPLRDRQVDDLLRDVMTGLQTWLPD----SRRGQAVAPLRRlPVAGVEhlrqTPGDlrpprap 381 Cellulomo...
WP_012085416       304 EQRRLLSASLRSHVLRHDPLRDRELDDALRACAERLTDWFAT--TGPRTTLDAGVAAGvSRLDVAslrtRLHDpaddaap 381 Kineococc...
Q8G6E6             391 PGLSDLAaEAPQSTPV--ADLRDMVNSGGPRllrmvslirrnpvtvdrsDDRPGATL-----------VDIAASFNRLPe 457 Bifidobac...
jgi:Jden_1567      380 PALVDDG------EVAaeLDRGYARAMGGPH------------------HKDIRQVLeaap---rhgyTTLAEVFQHAPt 432 Jonesia d...
jgi:Isova_2001     394 AELEDWA----ASDDAdgPALDDLRAMGGPQ------------------HAQIQAHLaalssgadaegLTVGEAFSRAPv 451 Isopteric...
WP_012878982       389 EPLTEWD-------DDeaGSLEHAAAWGGPR------------------YAALRGLLdea------ggARLDDVFAGGPd 437 Xylanimon...
WP_013583248       384 EPLASGT-------DDveFVDADTRAWGGPH------------------YAELEAYVarl-----gegFDLAEAFSGADa 433 Microbact...
CeBiTec:CVAR_1975  383 EPLHASE-------EApeFEGTEGREWGGPR------------------YEDLENYIgsre----dadFDLAEAFAHLVa 433 Corynebac...
CeBiTec:CGLY_05555 391 EPLRRED-EEGWDNPDieFLHADTRAWGGPH------------------YPELEQFVadl-----dgpFDLATAFGTVPd 446 Corynebac...
WP_013770914       382 APLAAWD------DDDlgADDHEVRAWGGPH------------------YAELHDHLrtfa---pdepVDVAAAFQAAPa 434 Cellulomo...
jgi:Cfla_2029      382 DALVEWD-------DDadVTDGDARAWGGPH------------------YADLEMHLrelga--dspaVDLAAAFRSAPe 434 Cellulomo...
WP_012085416       382 PPL-----RRHGEDPAggSSLSDLRRFGGPD------------------FERLREALgnpp---egpaPGTGALFESLPv 435 Kineococc...
Q8G6E6             458 SERRESEIVGFLGGLGAVSGNAIADEPSTDGvgvgvdsdiat---epapaqrgdtATWhc-vSIDGEPRNWItR 527 Bifidobacterium...
jgi:Jden_1567      433 ELQRPVDVLGFQEIMMNDAAPDLDEDHLATTqrqsskdtappadhgktvreehlpWDTvtavRPDGTTRTFL-V 505 Jonesia denitri...
jgi:Isova_2001     452 ELRRPVELLGYLELAGAGGLPEDEATSGDVPahale---------------------rvravRADGTEREFV-L 503 Isoptericola va...
WP_012878982       438 DARRPVDFVGLLELAARAGLDDLDEVAYVDTi------------------------------RPDGTRRRLAfe 481 Xylanimonas cel...
WP_013583248       434 ETRRPVDLVGLLEIVHRSGLTETDEVSVVEAv------------------------------RPDGTTRRFAfg 477 Microbacterium ...
CeBiTec:CVAR_1975  434 SARRPVDLLGLLEIAHRNGMVETGGVATVEAr------------------------------RPDGTVRRFAfG 477 Corynebacterium...
CeBiTec:CGLY_05555 447 DTRRPVDLLGLLEIAHRNGMEEGDDVSVVETl------------------------------RPDGTVRRFAfg 490 Corynebacterium...
WP_013770914       435 PLRRPVDLLGLLEIADQLGMTETGELAYVDAv------------------------------RPDGTRRRFAfg 478 Cellulomonas fimi
jgi:Cfla_2029      435 HLRRPVDLLGLLEIAHQRGMTESDELAFVDAv------------------------------RPDGSRRRFAfg 478 Cellulomonas fl...
WP_012085416       436 DLRRPADLMGLLHLAVAGGGADPREARGRAVya---------------------------ttRPDGVVHRFA-G 481 Kineococcus rad...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap