Conserved Protein Domain Family
DUF3363

?
pfam11843: DUF3363 
Protein of unknown function (DUF3363)
This family of proteins are functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 323 to 658 amino acids in length.
Statistics
?
PSSM-Id: 403141
View PSSM: pfam11843
Aligned: 26 rows
Threshold Bit Score: 355.811
Threshold Setting Gi: 303300943
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_013479933                    275 RSGRLVKLEALGLAEKLPGGRWRLDPELETTLRQMGERGDIIKTLH----RALKERGLea-sLSETQMHFps-aSSSGLA 348 Asticcacaulis excentricus...
BAI97809                        276 QASRLGRLVRMGLAEPLPTGRYRLDPDLETVLRAMGERGDIIRTMQ----REFSRLLLer-sSADRLIYD----PAEAGT 346 Sphingobium japonicum UT26S...
BAI95184                        298 LVARARVLERMELAEPAGPLSWSLAPQMEKTLTDMGMRGDIIRLMH----REMTREKEapriDADRYVVHgvdgVAAQMT 373 Sphingobium japonicum UT26S...
WP_013299774                    262 ermRLGKLQGMALAEPLGKGRWRLVDHAETDLRRMGERGDIIKAMH----RAMRDKGVar-tLDAGAIFD----PASEGA 332 Parvularcula bermudensis...
jgi:Paes_2343                   260 LFRRLQMLESLGLATSGQYGVWYMQEGWKERLRELGIREERFRTMH----DAIGGD------PSRYRIL-------GLEH 322 Prosthecochloris aestuarii DSM 271...
jgi:Paes_0632                   262 LTSRLQVLERLGLAEHEGGREWRMKPDWQQSLKAMGERSQIYQEIH----QEVGGD------PARYRIF-----DSKAHG 326 Prosthecochloris aestuarii DSM 271...
WP_013300173                    278 IQRRLEHLRGMGLASARGDGAWALEEGWKERLQTIGREGDRIREIA----AAFKTGD-----GLSGRVYD----PTHENV 344 Parvularcula bermudensis...
dbos:1099484000105_PB2503_12509 275 VNRRLRFLRTLDLARRREDGRWTLKEGWQETLRALGRRGDIVRSLAnlegRKIDASRLha-lPRDL-----------NSG 342 Parvularcula bermudensis HTCC2503...
jgi:Hbal_0680                   278 lRKRLTHLQNLGLAHQQKD-KWTFKIGWQDTLKQMGRRGDLIRSIN----DKYKNLDI----SNKFKIYD----RAKPPS 344 Hirschia baltica ATCC 49814...
jgi:Caul_2017                   279 RAGRLQTLARLGLAQEEAPTRWRLAEGLEDTLRRMGERGDIQKTLY----RALTQGGIdr-dRADQVIYQ----PAAADA 349 Caulobacter sp. K31...
WP_013479933                    349 STLTGRLIERGILEEHSDRHYVILEGIDGRTHYVDIGQGSHTEPL-PK----------EAILQVTPRRP-DIREVDRTVL 416 Asticcacaulis excentricus...
BAI97809                        347 PPLIGRILMHGLAGELEDRHFLLIDGIDGRSHYVPVGKGDTGDLLpPSqaegdssqpgGAVVAIRPREA-VVREVDRTIA 425 Sphingobium japonicum UT26S...
BAI95184                        374 GAVIGKVVKRGAADDDHERRYLIVDGIDGHSHYVDIGT--SAEPT-PV----------GGMVSLTPRQA-EPRAVDRTVI 439 Sphingobium japonicum UT26S...
WP_013299774                    333 RPVTGVILDKGVADDVNDRAFIVVDGHRGRPVHVVVGGEDRLASL-ET----------GRIVTVAPPNR-DPRRADHVIA 400 Parvularcula bermudensis...
jgi:Paes_2343                   323 REIEGRLTRIGIDDEYRDRYYYIIETRDGKAYYADAGRHSNEAAY-AE----------HDIVKAEMTVDsRAKKADIAIN 391 Prosthecochloris aestuarii DSM 271...
jgi:Paes_0632                   327 EGIEGRLAAKGLADELGDRYYCIVETPKGNSFYVQLDKGVNPEAF-RK----------GEIVSIRSEHEsWLKPTDRIIA 395 Prosthecochloris aestuarii DSM 271...
WP_013300173                    345 PAIVGRVVTDGPEEELRNRRYLILEALDGERWHVGLGE-TLPGAVpPK----------DAVVEISPAAR-SPRASDKTIA 412 Parvularcula bermudensis...
dbos:1099484000105_PB2503_12509 343 GEVLGQLAATLPGDELRNGTTALIEGLDGRVWSIEMTE-QEAAQLpKP----------GGIVSVGRKAV-EPKPADITIA 410 Parvularcula bermudensis HTCC2503...
jgi:Hbal_0680                   345 HGLVGRVLGSIPLDELKDTHALLIEGIDGQTWSVDIGS-TSKDKLpTK----------GHTVSVSHQDG-KTKSSDQTIA 412 Hirschia baltica ATCC 49814...
jgi:Caul_2017                   350 RPLVGRLVARGLSDELKDRHYLVVDGVDGRAHYVEIGRGLATDPI-PE----------GAVIRVEPRST-QARAVDHTVA 417 Caulobacter sp. K31...
WP_013479933                    417 AVAQANGGYYTTEIHLRFDPSAR-----------RSFAETHTRRLEAIRRTtGAIERLP-DGRFRIDPDHLDKVLAYERK 484 Asticcacaulis excentricus...
BAI97809                        426 AIAAGNGGRYDREAHRLHDPGAR-----------SDYVEAHVRRLEALARAgDIPGRSG-DGSWVIAPDHFGRVAAFERR 493 Sphingobium japonicum UT26S...
BAI95184                        440 QIAQAHAGRYSLGIHLNHDRDAN-----------EAFVETHVRRLEAIRKAtGKPEREA-DGTWKIGPDHLDTVRAYEQR 507 Sphingobium japonicum UT26S...
WP_013299774                    401 EIAAANEGRYSSALHMAHDKSAR-----------PEFVAAHIRRLEALRRA-GHATRAS-DGSWRVPEDYLDRAGDYEKA 467 Parvularcula bermudensis...
jgi:Paes_2343                   392 SIATKNDGIYSKEMHLASIKDDMirlsnrklvtkEEFVDAHVMRMHKLVSM-GLAEPAErDGEWVVDPDMQQKIRELDAK 470 Prosthecochloris aestuarii DSM 271...
jgi:Paes_0632                   396 EEAGKNGGKYDRHRHLKELEEQQvvsgk-aridkESLVDAIEKRLQRLRRF-RLVEMLE-DGTWRVDPSLIEKLQQKDRQ 472 Prosthecochloris aestuarii DSM 271...
WP_013300173                    413 RIAALNGGLYSDSLHKAFDPASR-----------ADYRLAHIRRLEALRRA-GFVTRDS-DGRFAIGADYLAKAARFETA 479 Parvularcula bermudensis...
dbos:1099484000105_PB2503_12509 411 AIAERNGGVYSDELHEATDPSSS-----------PAFRLAHKRRLEALRRL-GVVDRNV-HGTWAVPSNFEERALQAEAT 477 Parvularcula bermudensis HTCC2503...
jgi:Hbal_0680                   413 RIASLNNGLWSDSIHAVNDPASS-----------PQYRQALKRRLEALRRH-KIVSRNK-DGSWKVGQDYLAKVQAYETA 479 Hirschia baltica ATCC 49814...
jgi:Caul_2017                   418 AIAQANGGRYSVDLHLATDPTAS-----------AGFAEAHIRRLEAMRRGrASVERQE-DGSWIIGADHIEQAAAFEKR 485 Caulobacter sp. K31...
WP_013479933                    485 DVaRLPVSISVQASRALDKLVGYKGVTWLDRQWVTGPS--TEYAHT----GFGRALRSALQSRRQWLL-EEGLwmPVTGQ 557 Asticcacaulis excentricus...
BAI97809                        494 QLrIQPVMIEMLSPVGVADLATAHAATWLDRTLLDGDP--PQLRNA----GFGRDMADALARRRQWLV-EEGL--AEQGE 564 Sphingobium japonicum UT26S...
BAI95184                        508 KLrAEPVKVEMLSAGPILDQTNIHAATWLDRELTAPDK--APIASN----GYGQEVRKALALRQQWLV-EQQL--AEREG 578 Sphingobium japonicum UT26S...
WP_013299774                    468 AAlRRPVEIRVHSSLRLAQMQSAMGATWLDEHL-------RDFDDAgavhGFAGEVEAARIARRQFLM-QQGL--INREH 537 Parvularcula bermudensis...
jgi:Paes_2343                   471 QP-LYMVRVQRKGG-SLAHQETYRGRTWLDMYT-------DDPDAAgahyGFGKEVREAARRRAVFLQnELQVdpADPAR 541 Prosthecochloris aestuarii DSM 271...
jgi:Paes_0632                   473 HP-VSRLSMKRESGLSLQEQEVYRGRTWLDRFTAQGQV--DDAARY----GFGKELNGSIQRRVELLR-EMSIdpMDPAR 544 Prosthecochloris aestuarii DSM 271...
WP_013300173                    480 RT--GGVRVEVKSWLSVEAQITRRAPVWMD------DVdrESLTGK----GFGQDTASALSARRAFLE-REGW---LGED 543 Parvularcula bermudensis...
dbos:1099484000105_PB2503_12509 478 KH---GLAIDVRSWLPVEALAERHAETWLDQID-------TDVLDGat-gPFADELRKLLSIRKVWLR-TEGYtlDQTGQ 545 Parvularcula bermudensis HTCC2503...
jgi:Hbal_0680                   480 SL--EALKIETKSHFKVDKLVQVQALTWIDEIDP------RQCANT----GFGGQAKQAILARRLWLK-EQGL--MQAEQ 544 Hirschia baltica ATCC 49814...
jgi:Caul_2017                   486 QAeSAPVVVTTLSARPLDQQVGVAGATWLDRELIAEAP--EPLRDA----GFGRQARQALALRRQWLI-DQGL--ARQEQ 556 Caulobacter sp. K31...
WP_013479933                    558 GGEALDPSVLKTLRQQEMTDVAAGLEASTGKTCRTVPRGGLVEGRLREIIETESEK-YAVV--ERAKDFALVPWRPVLDK 634 Asticcacaulis excentricus...
BAI97809                        565 GEIRYRRDLLAVLRRRELLRVAGQLSRELALPFAETVEGEKLEGIYRRRVDLISGR-FAVL--ERSRDFALVPWRSVLER 641 Sphingobium japonicum UT26S...
BAI95184                        579 NDVIYRRNLLRILREREVRAVAGQLSKELGLIFAEPVPGERVEGTLTRKVTMTSGR-FALI--QRSFEFTLVPWRDELER 655 Sphingobium japonicum UT26S...
WP_013299774                    538 GRL--PQSVLDRLEAHDLKDAGDALAETLGKPYAPAPAAGRVRGIYTQAIERPSGR-YAVI--ERTRDFTLVPWRDVMDR 612 Parvularcula bermudensis...
jgi:Paes_2343                   542 AR---------QLDRIERQGLASEHSQKTGYRYRPAEKLMKLQGTVSDTGSLASGRrYAMItsERSREFTLVPWRKEYTA 612 Prosthecochloris aestuarii DSM 271...
jgi:Paes_0632                   545 AK---------ALDQIEKRDLARCIASRTGASLKELPAGGIMSGVMTDAGILASGRrYAQVvdLKSREFALVPWKPEFER 615 Prosthecochloris aestuarii DSM 271...
WP_013300173                    544 GRL--KPGMRDQLAAEELKSAADRIEGKGA--FLKLEDGMSISGVYERPVDLAQGR-FALV--TRSKEFTLVPWRPELER 616 Parvularcula bermudensis...
dbos:1099484000105_PB2503_12509 546 P----TAEDAERLKRTEFEKAMKTEGARMELSFAYPESWSEFSGTYSQHVELAQGR-FAVI--TGRDRYTLVPASHRNAV 618 Parvularcula bermudensis HTCC2503...
jgi:Hbal_0680                   545 NSL--SHQARTNLKAKEISSLANMETLNSARTFVSIEQTKSFNGKLERIVDAHQGK-LALI--GRDNSFTFVPLRSDMGN 619 Hirschia baltica ATCC 49814...
jgi:Caul_2017                   557 DQVIYRAGLLTRLQRRDLIVAAEGLGRETGLNFSEARPGQRIEGVYRRSVDLASGR-FAVI--ERSRDFTLVPWKRALEG 633 Caulobacter sp. K31...
WP_013479933                    635 HIGQEV-SGLM-REGG-INWTIGRSRSL 659 Asticcacaulis excentricus
BAI97809                        642 RVGQSV-SGLM-REDG-VSWSFGRGRGg 666 Sphingobium japonicum UT26S
BAI95184                        656 HVGKQL-SGLM-REDRpIGWTIGRGRSG 681 Sphingobium japonicum UT26S
WP_013299774                    613 NLGKSV-SGLI-RDGG-ISWTLTRGRGI 637 Parvularcula bermudensis
jgi:Paes_2343                   613 SLGKQAeVSRTvSGGRwMMRQIGKDlgr 640 Prosthecochloris aestuarii DSM 271
jgi:Paes_0632                   616 LAGKSVeLLKApQSGRyMMRQL--ERGL 641 Prosthecochloris aestuarii DSM 271
WP_013300173                    617 YRGAEI-SVKA-RTGG-IDWSVGRSKGI 641 Parvularcula bermudensis
dbos:1099484000105_PB2503_12509 619 WLGREV--TLN-RTGNsFQWQIGKSRSV 643 Parvularcula bermudensis HTCC2503
jgi:Hbal_0680                   620 SLGRDI--SLT-RRGPsIDWKIGRQKGI 644 Hirschia baltica ATCC 49814
jgi:Caul_2017                   634 QEGRAV-SGVL-REAG-VSWTIGRGRGg 658 Caulobacter sp. K31
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap