Conserved Protein Domain Family
DUF3339

?
pfam11820: DUF3339 
Protein of unknown function (DUF3339)
This family of proteins are functionally uncharacterized. This family is found in eukaryotes. Proteins in this family are about 70 amino acids in length.
Statistics
?
PSSM-Id: 403121
View PSSM: pfam11820
Aligned: 60 rows
Threshold Bit Score: 72.2118
Threshold Setting Gi: 75180559
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAJ85339       3 GDWGPVLIATAFFVVMLPGLICEIPGGGGrgRPEFHSMKTNGIAMFVHTVIFFAFCAIFMVAVGVHVY 70  domesticated barley
ABR25956      35 QDWGPVLISWVLFILLSPGLLFQIPGKCR--LIEFGKFQTSVVSILVHTILFFALDAIFLVAIGVQIN 100 long-grained rice
EDQ74214       2 VDAAALIIGVILFVLLSPGLLLQIPGDDR--PIEFTNQRTSIASIVVHAVVFTLVFYLLQLLFHVHgg 67  Physcomitrella patens
XP_006365033   2 NDWAGPIIATALFGFLSPGLLFQMPGKIT--PVDFMNMKTSWISILVHALLFGLILILVLVNFNLHLY 67  potato
XP_010660746   2 RDWAALLIASALFAFLSPGLIFQIPGRER--PADFMGMKTNIAAVFVHAVIYGLLLILFFIILNVHLY 67  wine grape
NP_198912      2 HDWAAPLIASALFAFLSPGLILQFPGKES--PVGFMNMKTTVASIFVHTVLYGLFLILFLVVLNVHVY 67  thale cress
RWW34202     226 KDWAPSIIATALFAFLCPGVILQLPGKHR--PVDFLNMKTSVVSILAHALLFGLLLLLFLVLLKAHLY 291 Ensete ventricosum
XP_015632021   2 KDWAPAIIASALFALLCPGGILQMPGRNR--PVDFMNMKTSLASIVVHAVIYGLLLMLFLVILEAHLY 67  Japanese rice
EES01756       2 RDWAPAIIATALFALLCPGGVLQMPGRQR--PVDLMNMKTSFPSMLVHAIIYFLLLMLFIVILQPHLY 67  sorghum
EMS47260       2 HDWAPAIIATALFALLCPGGILQLPGRQR--TVDFMNLRTSCLSILVHAVIYAVLLMLFVVILQAHLY 67  Triticum urartu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap