Conserved Protein Domain Family
Foie-gras_1

?
pfam11817: Foie-gras_1 
Foie gras liver health family 1
Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease. Foie-gras protein is long and has several well-defined domains though none of them has a known function. We have annotated this one as the first. The C-terminus of this region contains TPR repeats.
Statistics
?
PSSM-Id: 371742
View PSSM: pfam11817
Aligned: 18 rows
Threshold Bit Score: 188.405
Threshold Setting Gi: 146452670
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0UML5     353 RWDEIRLLADIVALRHIRCQLWNNYPTSAAQTWLRYKFRLRDVLDRRGKGT--SNYGWQAWEARWAQVMGQVIQRVELPA 430  Parastagonospora...
CAK45210   356 RFNDARLLGDALAIRIIRCLLMTGQTTPAVRFWTSHRNRSKDIIDRRGKGT--KSYGWAAWEARWSMVMAQLVRQASIPY 433  Aspergillus niger
Q0CCQ2     358 RFNDTRLIADTIAIRIIRCLLQMGQTTAAVRSWVRHRTRSQDIINRRGKGT--RNYGWEAWEARWSMVMAQLIRQARIPY 435  Aspergillus terr...
NP_201396  270 RLVEIKIIAEQLHFKISTLLLHGGKLIEAVTWFHQHKTSYEKVVGS----TefIFLHW-DWMSRQFLVFAELLETSSATG 344  thale cress
Q6ZFT6     256 RLVEVKAVAEQFHFKISTILLHGGKVVGAITWFRKHIRSYERVVGS---PEv-AFLHW-EWFSRQFLVFGELIETTSTTV 330  Japanese rice
Q7Q5C6     260 NCLELKTIAGFVNYKMCKLFFRLNAPKDSISQFKNHIGKYRQRSGFke----lLFEHY-AWLSVQYSAFAELFCDAVKNG 334  Anopheles gambia...
Q8IRE3     265 NCLEIKTLAGFLNYKICRLMFKLKTPRDAINQFIIHVEKHKSRVGFkd----lAFEHH-AWLSTQHSVFAELFCEAIKNG 339  fruit fly
Q1RLX4     263 NVLEIKTMAGFINYKICRLCFQHNTPLDAIAQFRKHIDLCKKKIGS---AEl-AFEHT-AWMSKQFQSFGDLFDEAIKLG 337  zebrafish
EDO31414   261 NMLEVKVVAGFINYKICRLSFHASAPLDAISQFRKHVDLWKEKIGCpq----lAFEHV-AWLSKQFSMFGDLFDEAIRSG 335  starlet sea anemone
EDK46926   351 QFM---TLLDVIAFHIVRAYFSIEEPIKALKKHKTHIVNVVEVVKR-----------DHDWVSRQYEWLAQLMRLVPYSI 416  Lodderomyces elo...
Q0UML5     431 FRILQPGSDPLNSTitavyslpekqfpigerlpPWDCLHHAGYWYKLSAD-HAKRRYILAREM-------------PEED 496  Parastagonospora...
CAK45210   434 FTSVGIPQDQFQEQysifvprdk-svsisdayiPWEQLHHEGYWLYRAAQ-HTMYRRTLAEQI-------------PEDD 498  Aspergillus niger
Q0CCQ2     436 FTSVGISQDQFNEQysifvprek-tthpgdiikPWEQLHHEGYWLYRSAK-HSMQRRLLAEQI-------------PAED 500  Aspergillus terr...
NP_201396  345 QSLTSSNQGTAEIS-------------------LTEFEFYPAYYYQLAAH-YLKDKKSALELLlsms-----eiaqEI-- 397  thale cress
Q6ZFT6     331 PDTLSPRFGTADNA-------------------LTEWEFQPAYYYQLAAN-YLREKRYALEFSsssv-----sltkGV-- 383  Japanese rice
Q7Q5C6     335 LAPLQTQH--------------------------------PGIYFHKAAE-YIGLRKEAFLQCtalgtag---------t 372  Anopheles gambia...
Q8IRE3     340 LPALQTQH--------------------------------PGIYYHKAAE-FVMKRRDAAMEAyaamqasseatptPI-- 384  fruit fly
Q1RLX4     338 LTAIQTQN--------------------------------PGFYYQQAAY-YAQERKQQAGQLcshepgvgypapdPL-- 382  zebrafish
EDO31414   336 LTALQTQH--------------------------------PGFYYQQAAN-NAIIRRQLGAVTpqt--------mdPL-- 372  starlet sea anemone
EDK46926   417 ITNLNTT---------------------------------AILKQQLENRrNARPQSSAASSA----------------- 446  Lodderomyces elo...
Q0UML5     497 RTPPGMSPATRVSNRNQVYDQY-----------LVPEPHQEFPVSGVg-GGFEHWADISAKLRAAATEFQARGQ----HR 560  Parastagonospora...
CAK45210   499 RVPPGQSPASQIANKSYLYDTY-----------LVPEPHVEAPQPGA--VGFNHALLRLNALKAALEEFSKRDQ----TR 561  Aspergillus niger
Q0CCQ2     501 RIPPGQSPASQIASKAYLYDTY-----------LAPETHIEAPQAGS--TGFDHSNVILKALNAALEEFSKRDQ----VR 563  Aspergillus terr...
NP_201396  398 -----DSSSASITPSVYVGQFAqllekgeaitlHSITDEEYTRYTISeaKRVQDSLQIIAWLKRSYESFTNLKA----QR 468  thale cress
Q6ZFT6     384 -----NGLPESVMPSVYVGQYVrlfeqgdtvavLPLSDTEYTSYALSeaERFQDSYEIIALFRKAYESFRSLGA----TR 454  Japanese rice
Q7Q5C6     373 geqfgTISNSALYSDFFGIRGSvk-------tgEPVSEQQIICLVQEneKSYNHSGEIIGLLGKAMAQFKVYRC----LR 441  Anopheles gambia...
Q8IRE3     385 -----QNPLS-LYTEFFGIRAVkt--------gDLVAEQQANMQLCDqeRSYNHSAAIIALLSQAMAQFKIYKC----LR 446  fruit fly
Q1RLX4     383 -----ETTSGAL--DFYGQRPWrqghq-sidppDSEKEKQGILALQVkeRDVLHSELIIALLSNAVAQFKKYKC----PR 450  zebrafish
EDO31414   373 ------ENAGKL--DFFGQRPWrqgfq-gieltDQTLEHAGIVALQSqeVMVDHSWIIIPLLSSAVAQFKKYKS----PR 439  starlet sea anemone
EDK46926   447 -----AASSSSSSVSLLAFFGGirtpefdlvtnPGLVYVKAYELSSDpqKRIALLTNAIELLETQLLNATYKNLisgkDK 521  Lodderomyces elo...
Q0UML5     561 KVDQLQL---EVARTLLHVKRFDDAFKVLQPLwqTMAWRKEGWWPLASEVLWALHECALRVQDREAYLATEWELYSQ 634  Parastagonospora no...
CAK45210   562 KAESLSL---EIAEEYMRLGSWPEAYETLRPLwpTLSWRRSGWWPLMQRFGWALRECAVRVSDSDMVLRVDWELRHK 635  Aspergillus niger
Q0CCQ2     564 MTERLRL---EIAEEYMRIGSWAEAFNVLQPQwaTLSWRQAGWWSLMERFGWALRKCALQVQDSETILRVDCELLNR 637  Aspergillus terreus...
NP_201396  469 MAALCAF---EVAREYFDLADPNNAKFFFDIA--ANLYRQEGWVTLLWEVLGYLRECSRNLDALKDFVEFSLEMVAl 540  thale cress
Q6ZFT6     455 MASACSG---GMAIEYYAAGDFSNAKQLFDGV--AGLYRQEGWATLLWENLGYLRECARKLKSLKDFISYSLEMAAl 526  Japanese rice
Q7Q5C6     442 FRKKLAI---DMAEEYLKSGDHSKALTLYSLM--LTDYRVDKWYTIFTQVLLKTLHSAYLSASVPDFVACSIEALSP 513  Anopheles gambiae s...
Q8IRE3     447 FRKKLAI---DMAEEYLKSGDHAKALTLYSLM--LPDYRQEKWTTIFTDVLLKTLRCALLSGSVADYIACSVEALSL 518  fruit fly
Q1RLX4     451 MKSHLMV---QMGEEYYHAKDYTKALKLLDYV--MCDYRTERWWSLLTSIVCTALKCSYLMGQVKDYITYSMELVGR 522  zebrafish
EDO31414   440 MKRYLMV---QMGEEYYHARDYSKALVLLGRV--TWDYRRERWWALLTSVLITSLRCAYLVGNVKEYVTLCFELMGR 511  starlet sea anemone
EDK46926   522 LDALISYinwRIAEELIQMKQYQKASDFLEMA--YSLICDSNWFSINHLLLEKLLFCYKNIGDKKMEINTILKLATM 596  Lodderomyces elongi...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap