Conserved Protein Domain Family
DUF3326

?
pfam11805: DUF3326 
Protein of unknown function (DUF3326)
This protein is functionally uncharacterized. It is about 300-500 amino acids in length. This family is found in plants and bacteria.
Statistics
?
PSSM-Id: 403110
View PSSM: pfam11805
Aligned: 48 rows
Threshold Bit Score: 389.605
Threshold Setting Gi: 81606501
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q46J60            8 PTLLIIPTGIGCNVGGYAGDAIPAARLLASASGCLITHPNVMNGGSLYWPDNCIQYVEGYSLNLFASGEVFLKPVRQQKV 87  Prochlorococ...
ASGPB:GKIL_1020   5 TVVLLVPTGVGAAIGGYAGDAIPVARLLAGVADRLVTHPNVLNGALLSWPLPNALYVEGYALDRWCRGEWALRPVHRNRV 84  Gloeobacter ...
Q7NN57            5 VVLLLVPTGVGAAVGGFAGDAIPVARLLAGVADCLITHPNVLNGALLSYPLTNALYVEGYGLDRFCKGEWRLRPVHRNRV 84  Gloeobacter ...
Q10XC3            1 mVVNIIPTGIGCSIGGYAGDATPTANLLASTVDYLITNPNTVNASNFINLKNNVVYAEGHSIDLFCGGYINFHLPYANTV 80  Trichodesmiu...
jgi:Haur_1880    73 aVLNIVPTGVGCDIGGYAGDAGPATALLASCCDYLVTNPNAVNASNFILMDKNLVYTEGYCIDLFSRGLINLHLPYSNKI 152 Herpetosipho...
Q63KB2           85 NAVLIVPTGVGAEIGGHDGDAGPVAMLLSSICDRLITHPNVVNAADINELPANGLYVEGSVICRLLLGQIGLQPVRANRV 164 Burkholderia...
WP_011936289     16 PTLLVIPTGIGCEQGGFAGDALPVARLLAAASDCLITHPNVMNGAALYWSDPRIHYVEGWSLDAFAKGSLRLRPQRRQRI 95  Synechococcu...
jgi:Cyagr_3097    9 PTLLVIPTGVGCAVGGFAGDGLPAARLLAAASGCLITHPNVMNAASLYWSDRRLHYVEGWSLDRFAAGDLALAPVPSQRV 88  Cyanobium gr...
CAK24438          6 PTLMIVPTGIGCEIGGYAGDALPAARLLAAASGCLVTHPNVMNGAALYWSDERIFYVEGWGLDRFAAGELALRGGRRQRI 85  Synechococcu...
Q7V5T1           18 PTLLVVPTGIGCEIGGYAGDALPSARLLAAASGCLITHPNVINGAALYWSDPRIQYVEGYSLDRFAAGELGLRPVRQQRI 97  Prochlorococ...
Q46J60           88 GLLLDAGLESDLKKRHLQVADGCVASLGLDIGPVMTTEKAIQINLKKGMSGSSWGNIEEPDVLLRAAEKLK-QAGATAIA 166 Prochlorococ...
ASGPB:GKIL_1020  85 GVLLDAALSDSQRLQHLQAIEAARFTLGVDILGHCTSEGALGILVHPGSTGTAWGTIAHPDRLLRAAERLV-AAGADAIA 163 Gloeobacter ...
Q7NN57           85 GVVLDAGLSASQHQQHLHALEAARYTLGVDILGHCTTEGPLGVEICGGAVGTAWGTLRHPQRLLAAAQRLA-TAGAEAIA 163 Gloeobacter ...
Q10XC3           81 GLIIEKSEDWKIDIL-FNLINAVRAIYGVNIIDPVITDEPIYSRCIQNEVGAFVGSVDNPEVLINAGQELI-QKGANAIA 158 Trichodesmiu...
jgi:Haur_1880   153 GLIIEKTDAEHLDVV-FNILNTVRAVYGVNIEEFVITDEAIGGRCIQHSSGSYVGSIDNPATLFRACEQLI-AKGVTAIA 230 Herpetosipho...
Q63KB2          165 LAVVGSNECPTFVNAAINAVNAARAAYGLDCPRVLHLDPGIRLTSTYASSGRAAGTVENLDALVALLAEHRdTFDAVAIA 244 Burkholderia...
WP_011936289     96 GVLFDAGIEPELLLRHRQVLAAARATLGLDIGPELVSDEPLGVRLSQASSGSSWGQLEQPGALLRAGSRLK-HAGATAIA 174 Synechococcu...
jgi:Cyagr_3097   89 GVLLDAGIEAELLLRHRQVIDACRASLGLTIGPVLSSDRPLEVSLSIGPSGSSWGSLGRPDALLRAGEALL-AAGATAIA 167 Cyanobium gr...
CAK24438         86 GLLLDAAIEPCLRDRHLQVADACRATLGLEIGPVVTTDVALGVTLRQGESGVSWGSLEHPDALLRAGETLR-DAGASAIA 164 Synechococcu...
Q7V5T1           98 GLLLDAGIEPELRQRQWQVAEGCRASLGLNLGPVVTTDVPLEVRLREGSSGASWGELGQPDALLRAGEQLR-DAGASAIA 176 Prochlorococ...
Q46J60          167 VVTRFPDESDELETKLYRQGH-GV-DIIAGVEAVISHFLVKHLLIPCAHAPGL-APLPID---YDLDPRTSGEEIGYTFL 240 Prochlorococ...
ASGPB:GKIL_1020 164 IVSRCPEVDDS----AYLGGR-GV-DPIGGVEALVSHLVVRHLGRPAAHAPAF-DYAAEP---QPVHPRVAAEALGPTFL 233 Gloeobacter ...
Q7NN57          164 VVSRCPESDDT----AYRAGR-GV-DPVGGVEAVISHLVVRHLQLPAAHAPAF-DYDPLP---GPVHPRVAAEVLGPTFL 233 Gloeobacter ...
Q10XC3          159 ITTNV-QDLPSEIYAKHFRGE-CP-NPVGGVEAIMSHLMMKKFQIPVAHAPLL-NIKDLDlvnNIVDARGAGEMASTSGL 234 Trichodesmiu...
jgi:Haur_1880   231 VTSNI-QDLPADSYAEHFSGR-HP-NPVGGAEAIISHLIAKKYRLPAAHAPMI-NLKQIDledPIVDARGAGEITSHSGM 306 Herpetosipho...
Q63KB2          245 SHIHVPDACRT----GYYAGTlGLvNPWGGVEAMLTHTLSTLFSVPSAHSPMYeDPRFAVrdyGIVDPRIAPEVVSLTFL 320 Burkholderia...
WP_011936289    175 VVARFPDDNGSDALQAYRNGS-GV-DALAGAEAVISHLLVRELQIPCAHAPAL-APLAPM---AELDSRAAAEELGHTFL 248 Synechococcu...
jgi:Cyagr_3097  168 VVARFPDEPGSDALAAYRHGT-GV-DALAGAEAVISHLLVRHLGVPCAHAPAL-APLPPD---PGLDPRAAAEELGHTFL 241 Cyanobium gr...
CAK24438        165 VVARFPDDCGSEALEAYRHGS-GV-DGLAGAEAVISHLLVRHLQIPCAHAPAL-APLPLD---PQLDPRAAAEELAHTFL 238 Synechococcu...
Q7V5T1          177 VVARFPEDPQSEALRAYRQGS-GV-DALAGAEAVISHLLVRELGLPCAHAPAL-SPLPCD---PLLDPRAAGEELGYTFL 250 Prochlorococ...
Q46J60          241 QSVLVGLSRAPDLIYKSEMkvkentlfQVNTFLSNRDLGAVVVPQGALGGEAVLSCIERFI---PLIIV-SNQGVLNVSS 316 Prochlorococ...
ASGPB:GKIL_1020 234 PCVLAGLSTAPRYVRADAA---------HPSDLLPTQVDAIVAPVGCSGGPGLLALM-AQTtppVLLAVeENLCRLDVTP 303 Gloeobacter ...
Q7NN57          234 PCVLAGLARAPRFVSGPGV---------LPQDLAAAAVDVVVSPVDCCGGAGLLALM-DSTnrpVLLAVeENTTRLNVTP 303 Gloeobacter ...
Q10XC3          235 ACILVGLQKAPQIKQSKNR---------IADIININNVLAVVIPTTCLGGVPILQAEKYNI---PVIAVrENQTILDVSQ 302 Trichodesmiu...
jgi:Haur_1880   307 ASVLIGLAQAPQITARPTC--------RIADTININNVVAVVTPASALGGIPVLYAQKFNI---PVIAVhNNATILEITP 375 Herpetosipho...
Q63KB2          321 QCILKGLRRAPRIVELARAg-------NAAGTLSVSDVSCIVIPQGCVG-LPVLAALAQRI---PVIAVrENRNVMRNDL 389 Burkholderia...
WP_011936289    249 PCVLVGLSRAPDLCPASEP--------WRSQELAIDQVGAVVAPAGALGGETVLACADRGI---PIVAVrSNPSLLQVDA 317 Synechococcu...
jgi:Cyagr_3097  242 PCVLVGLSRAPSLRPEPAT---------GNGLLHGADVGAVVAPAGALGGETVLACAERGV---PVIAVeGNPCLLQVSG 309 Cyanobium gr...
CAK24438        239 PCVLVGLSRAPDLIQSATA---------QPGDLLASGLRALVVPEGALGGEAVLACLERNV---PVIAV-SNPSVLQVSS 305 Synechococcu...
Q7V5T1          251 ACVLVGLSRAPDLVPLTIEea----lpAGAELLHAEQLGAVVAPEGALGGEAVLACLERGV---PLITV-TNPSVLKVTP 322 Prochlorococ...
Q46J60          317 TKMRLDslsgnrdknILY-----AENYIEAAGLITALRHAINVKSLR 358 Prochlorococcus marinus str. NATL2A
ASGPB:GKIL_1020 304 ERLGLK---------ARR-----VRSYLEACGWLVALKQGVALAegt 336 Gloeobacter kilaueensis JS1
Q7NN57          304 ERLGLK---------VRR-----VRSYLEACGWLVALKQGVAFAegt 336 Gloeobacter violaceus
Q10XC3          303 SKLQLNn--------VIE-----AHSYAEAAGLILALKNNIHLASLS 336 Trichodesmium erythraeum IMS101
jgi:Haur_1880   376 DRFPLNt--------VIE-----VQNYAEAAGIIMALKRGLNLKSIL 409 Herpetosiphon aurantiacus DSM 785
Q63KB2          390 RSLp-----------WAPgqlriVDNYWEAAGVLASMRAGLNPDSVR 425 Burkholderia pseudomallei
WP_011936289    318 AALDLA---------VVP-----AADYSAAAGLVLAWREGLDPRALM 350 Synechococcus sp. RCC307
jgi:Cyagr_3097  310 EALGLP---------VIP-----AASYAEAAGIVLALREGLDPAALR 342 Cyanobium gracile PCC 6307
CAK24438        306 QSLGLEd-------rVIA-----AASYAEAAGLVLAMREGVALPSLQ 340 Synechococcus sp. WH 7803
Q7V5T1          323 EALGITs-------gVQR-----ASSYAEAAGLLLALREGIAKDSLQ 357 Prochlorococcus marinus str. MIT 9313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap