Conserved Protein Domain Family
CENP-K

?
pfam11802: CENP-K 
Centromere-associated protein K
CENP-K is one of seven new CENP-A-nucleosome distal (CAD) centromere components (the others being CENP-L, CENP-O, CENP-P, CENP-Q, CENP-R and CENP-S) that are identified as assembling on the CENP-A nucleosome associated complex, NAC. The CENP-A NAC is essential, as disruption of the complex causes errors of chromosome alignment and segregation that preclude cell survival despite continued centromere-derived mitotic checkpoint signalling. CENP-K is centromere-associated through its interaction with one or more components of the CENP-A NAC.
Statistics
?
PSSM-Id: 371733
View PSSM: pfam11802
Aligned: 16 rows
Threshold Bit Score: 206.079
Threshold Setting Gi: 46396678
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_016160370   7 EISNATGPVDAKEELLDECQSIWKEMEEYQSKLM---------LLGTETLLPSDAKLSLLLLQWKTLSVECHQWQVKSPE 77  Collared flycat...
EHB02756      10 STTDMEVVTDIEEELIKACEEMWKDMEECQNKLS---------LIGAETLSNSNAQLSLLIMQVKCLTAELSQWHKETPE 80  naked mole-rat
XP_003759448  12 DILDKEYVMDRKDRIIEECEELWKQMEKYQQEIT---------LAEGERLNCSDAQLTLLMMRLKNLTAEYNQWLERTPD 82  Tasmanian devil
XP_016286804  12 DIENKEYIVDRKDKLIEECEELWKQMEKCQQEIA---------LAGGERLNHSDAQLTLLMMRVKSLTAECNQWLERTPD 82  gray short-tail...
XP_007663629  12 ITTDASYAAEAKEALINECEELWKQMEECQNKLS---------SLGPETLTDSDAQLSLLIMRVKGLTAERNQWQKRTPE 82  platypus
XP_015132795  30 iMSDSVCPIDAKEELLRECENIWKEMEKCQSKLT---------LLAAEPVPESDAKVSLLLTRMQALRAEYHQWQKRNPE 100 chicken
XP_002934240  29 ISKTSQAPEEAREELLQQCEEIWKQMEECQSKLT---------MSGPETLPEMDVQLYLLMMQVKALTAEYEQWQKRTPE 99  tropical clawed...
XP_001628227   5 ensSVTEKTSYMQDLKDQCEGLWLHIHQTHARLRsraenmtcfLPGEENL--EKIHEEILKAKEKRLQAEYAAIESSGVE 82  starlet sea ane...
NP_001243594  17 TSEDTGCMSAAKAVLLDECEEQFGLLQKLQNEII---------MADTEAY---DDQSNEAVNRLIAITSELEQWQEIEPK 84  zebrafish
XP_005997501  29 LTANGQRSAEAKEILVQECEVVWREMEECQRKLS---------LLEPEALLDSDVQLSVLMARVKALMAEHNQWQNRKPD 99  coelacanth
XP_016160370  78 IISTNPEVLLELGKEELQKVKNDLEMVLSAVRSKNKKLEEDLKREKQWYEEQKHMTAALTKIEEEAKPQVGQPSTE-RLe 156 Collared flycat...
EHB02756      81 NCSISFPFGVALGDLEFQKLSHDLEMVLSTIQSKNENLKEELEREQQWLDEQQEIMKSLNVIYSELKKQVVTFSES-RI- 158 naked mole-rat
XP_003759448  83 IIPLNPESLITLGKEELQKLHHNLEMLLSTVQSKNQQLQEDLRREQEWLNEQEELGASLNEMCKELKNQVIPVSEK-RT- 160 Tasmanian devil
XP_016286804  83 IIPLNPESLVVLGKDELQKLDHNLEILLSTIQSKNQKLKEDLTREQEWLNEQEHLVTSLSKKCKERKNQVIPFSEQ-RT- 160 gray short-tail...
XP_007663629  83 IVPNNQDILSALGKEELQKLDQDLEMVLSAVQAQNVKLKEDLRREQQWLNEQEQLIESLKVTHDELKTQEVHFSEE-RA- 160 platypus
XP_015132795 101 LISTNPEVLLLLGEEELQKVKKELEMVLSAVQLKNEKLKEDLEREQQWHDEQVQILNAFKEIEEEMKKEVVTDSEK-RV- 178 chicken
XP_002934240 100 IISDNQDVLLAVGKEELDKVARELEMVLSSVQAKNKKLKKDLEKEQNWLDGQQKLVDALTSRQDELKNQLSTFSEK-RV- 177 tropical clawed...
XP_001628227  83 VPSMKEEYLDASLKQQLAQNTSQLDDTLLILKSKRKEIAEQLEREKEILEQHKDIEISLLNKTKKIEDTKENFQSGtSK- 161 starlet sea ane...
NP_001243594  85 LLTTNTEVLLAVGKKELQRLHSQLKMVLSCSQAKLDAQKKILKREQTWQSEKQEALNSVTEKIARLQ------QEKqKSd 158 zebrafish
XP_005997501 100 VLCTNPEVLVTLGKEEIQKVNKELEMVVSCVLMKNKKIREDLEREQKWLAEQQELVKALAERHQALKTDVVQLSEK-RA- 177 coelacanth
XP_016160370 157 ikeSSELKNKILKLKTFKKKLLTTLGEFLDEHFPPLEegeNT--ENK----NSSTKPA-VKLITLKEILESLINKLLTTP 229 Collared flycat...
EHB02756     159 ---FNELKTKILYIKEFKEKLLITLGEFLEDHFPLPN---GTlkKKK----KNIQEAT-KQLITLHEVLEILINRLFDVP 227 naked mole-rat
XP_003759448 161 ---FLEMKTKMTKIKKHKEKLLTSLGEILDKHFPLPEengS---KKR----KRECQPN-AQLITLHEILEILINALLHSP 229 Tasmanian devil
XP_016286804 161 ---FFEMNTKMTKIQSQREKLLNSLGEFLDKHFPPPEengN----KR----KRECKPT-AQLKTLREILEVLINSLLRSP 228 gray short-tail...
XP_007663629 161 ---VRELKSKMIKIKAYKEELLSALGEFLDNHFPLPEedeNVkkKKK----KKCAGPT-VQLISLHEILEILISKLLTAP 232 platypus
XP_015132795 179 ---FQELKNQMLELKEYKKKLMNALGEFLEEHFPLPEkngNA--KKK----RYSEEPP-EQVITIHEILEILLNQLMSTP 248 chicken
XP_002934240 178 ---FQDIANKLFKVRAYKEELLSALGDFLEEHFPLPEeqeNQskKKK----GQSGKKT-VPLMTLHEILEILINKLMTTP 249 tropical clawed...
XP_001628227 162 ---VRELERKQRIAETQLKQVMRKLGVFLREHFPLPTledVEvkRKTvlqgEQTLDPT-INYVTLQEMLEELMNTQHDRP 237 starlet sea ane...
NP_001243594 159 hsvSQEMKRKIHKLKEYHSSLMEMLSDMLAEHFPLPDpqeNGskKKR----AAAYDAAeINLISLSEIIERLTNKTLETP 234 zebrafish
XP_005997501 178 ---LQELGGKIQKIKVYQEELLIALGTFLEDHYPLPKqwgNAskKKK----TQVDEPC-LYLITLHEILENLINKLMISP 249 coelacanth
XP_016160370 230 HEPYITINESFWPPYIELLLRYGIAVRHPQDPGRMRLQPF-Q 270 Collared flycatcher
EHB02756     228 HDPYVKISDSFWPPYIELLLRNGIALRHPEDPTRIRLEAFhQ 269 naked mole-rat
XP_003759448 230 HDPYVKINDSFWPPYIELLLRTGIVLRHQDDPSQIRLEAFhQ 271 Tasmanian devil
XP_016286804 229 YNPYVKIDDSYWPPYIELLLRNGIALRHQDDPNQIRLEAFhQ 270 gray short-tailed opossum
XP_007663629 233 HEPYVAIQDSFWPPYIELLLRSGIALRHPEDPNRIRLEAFhQ 274 platypus
XP_015132795 249 HEPYVTVDDSFWPPYLELLLRSGIVLRHPEDPNRIRLEAFhE 290 chicken
XP_002934240 250 HDPYIVIEPHHWPPYIEMLLRYGIALRHPEDPNRIRLEAFhQ 291 tropical clawed frog
XP_001628227 238 HDPFMQLQPHHWPPYVELLLRCGLVLRHNQDSNQIKLESF-N 278 starlet sea anemone
NP_001243594 235 HDPYVTIDDTFWPPYTEMLLRNGIAMRHPEDCNKIRLENFf- 275 zebrafish
XP_005997501 250 HDPYITIDDSYWPPYIEFLLRYGIALRHPEDPHRIRLEAFhQ 291 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap