Conserved Protein Domain Family
SID

?
pfam11778: SID 
Septation initiation
This family is required for activation of the spg1 GTPase signalling cascade which leads to the initiation of septation and the subsequent termination of mitosis. It may act as a scaffold at the spindle pole body to which other components of the spg1 signalling cascade attach in pombe. In S.cerevisiae it is both required for the proper formation of the spindle pole body outer plaque and may also connect the outer plaque to the central plaque embedded in the nuclear envelope.
Statistics
?
PSSM-Id: 403090
View PSSM: pfam11778
Aligned: 20 rows
Threshold Bit Score: 146.969
Threshold Setting Gi: 444315458
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003957747  432 LKFLEGDFSKRITFETIHQKNPEkFTKEIYDYLEFPTIDNMNLIELQNIIKHFSLFFEVPLSKFFKKLPTICIYLRYERN 511  Kazachstania ...
XP_003670940  394 IRDIQGDAAERIKYDRYQLMKLG-ITEDLFKTYGIDEVEILDKISLENIVKRTMVLLNIPFNELNTKISRIAVFLRYEKP 472  Naumovozyma d...
XP_003677377  351 LELLEGDKENMVVFDKETLTRFG-VNGDIAKYLSLTQVNSVDRITLINTVKRIMIFLQMSYTDLPDKIQRLAVYLQYEKP 429  Naumovozyma c...
CCH61969      875 LEKLTGDKSLRITENNIRNTFKGdGSNSLIENLKLDQVDELTMIQLQNALKNIIVSLKIPFDKFSYKMPLITIYIHLERV 954  Tetrapisispor...
XP_003675959  465 LKKKMGDATEMITFSNTCKVRLD-ITKDMYERLMVDDVEKMNLVELQNIIKNLILLFEIPLNKLTKRLPLMVIVFMYEKP 543  Naumovozyma c...
CCF56228      394 LNKLRGDSSELLTFKDFKNSD---IDKRLYQALQVDKVEQLDLVQLQNKMKKVIVDMQTPLDKLDAKLPLANLLIKSELV 470  Kazachstania ...
Q6FP18        394 LLSITGNTNNMLSFEKLKQLDNS-FCKEEYVSLKISEIEDISLVQLQNMAKMICMYFRTPFDKLDIKLPLAAIQIIHERK 472  [Candida] gla...
Q6FWH7        482 LQNLEGNIEESLTEEALKVRFIS-LSSENYNTLDVECIDRQDLVSLRNLLKVLTLTLEIPFSKLQTTIPLLAIRLYHENT 560  [Candida] gla...
CCK70756      397 LNRVVGDAANKIRYASLKHVH---MTKEKYDELAIDSVEQYTLTELQNIVKRASLELEVPPSTLLVNLPRLNVAIE-QQV 472  Kazachstania ...
Q6CQ58        615 YEKVKGNAADKITPDTLMKIHTH-MNKESYENLELDTIDNLNLVECQNTIKNIVAILDISYSKLSSKLPLVNIMLRYEKT 693  Kluyveromyces...
XP_003957747  512 LLHFFVDRLNYQIYNpsKKINFKSYTVDAYQQYLKNgNSFEDINHPLQKCLDDLYNEI 569  Kazachstania africana CBS 2517
XP_003670940  473 LLRKFVTELHMATFG--TSADLIYKANRATKQFNTT-GDLTHIDHPLNRCLDKLLNQL 527  Naumovozyma dairenensis CBS 421
XP_003677377  430 LLRKFVNELHRMVFG--EPIDLVNKAAVAYSQFSKT-GDMNSINHPLEKCLNNLIDHV 484  Naumovozyma castellii CBS 4309
CCH61969      955 IFLKFINRIHFKLHD--RYFEMERFTTEAYVQFMNT-HDLNTVKHPIATYLHSMLKEL 1009 Tetrapisispora blattae CBS 6284
XP_003675959  544 LFSYFVNRLFYQIKN--EQLDLKHFTDDTYRQYLEG-NSIKNLNHPLKDVLEELFQYI 598  Naumovozyma castellii CBS 4309
CCF56228      471 ITLDFINRLYQTMYN--EGLDFNHYTEEAYLQYRKS-NYLDPWQHPIRPIIDHLYNDI 525  Kazachstania africana CBS 2517
Q6FP18        473 ILIHFANILNEYFMS--KPLSMKKCTDSAYCEWQLS-HNIFRIEHPLKFKLEELYTTI 527  [Candida] glabrata
Q6FWH7        561 SLLSFCNTLHMHLYG--KPLAIKNYRRWAYADYLKT-CNIHEVQHPIKPILEAMFNKI 615  [Candida] glabrata
CCK70756      473 ILMKFAYWTLQVFAN--QELDVLSFTERAVEVYETT-GCMTDALRPLEQTMQGLrtll 527  Kazachstania naganishii CBS 8797
Q6CQ58        694 MLFHFANKVHNLLFH--QEIDFKTFTKKALENYWTH-RNAKEIQHPLEQCLKDLYKSV 748  Kluyveromyces lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap