Conserved Protein Domain Family
PulG

?
pfam11773: PulG 
Type II secretory pathway pseudopilin
The secreton (type II secretion) and type IV pilus biogenesis branches of the general secretory pathway in Gram-negative bacteria share many features that suggest a common evolutionary origin. Five components of the secreton, the pseudopilins, are similar to subunits of type IV pili. Pseudopilin PulG is one of the secreton pseudopilins, and is found to assemble into pilus-like bundles. PulG interacts with proteins H, I and J within the multi-protein complex as well as blocking extracellular secretion and reducing the amount of PulE protein as well as the amounts of PulL, PulM, PulC and PulD when G is over-expressed. In Klebsiella the pilus-like structure is composed largely of PulG.
Statistics
?
PSSM-Id: 403086
View PSSM: pfam11773
Aligned: 7 rows
Threshold Bit Score: 95.8814
Threshold Setting Gi: 503790184
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8DS53        13 ILLESLVALGLFVTITTLILTQLSHYQERTAKNLQKQEILNLAIMALQTQQDHLSFNGVSVTVVKNQGETIVYHDHEEVI 92  Streptococcus m...
bgi:05SSU0130 13 ILLESLVALATLVTICSLILSAVDAGRRRQVWELEQQEVFNLAQMAVQTKQDDLALNGVAVQVQRTAERVAVFHEGKEVL 92  Streptococcus s...
Q5M2G2        13 ILIESLVAMAVLVLVSSLILEQINTNRRLMADNLHQQEVLSVATMAVQTKQDQLTLNGIAVTVKRSQQGITVYESGKEII 92  Streptococcus t...
WP_014024178  15 LLLESLIAMSLLIFFVTVVLEQVIQVKKQTAMENREIEALNVAHMAVDTGKKYLKLNGVEISIEETSTQMTIRESGEVL- 93  Lactococcus gar...
Q9CDU2        13 LLLESLISIALLAFLVSFIVSSLVQVRQKDTEENQKIEALNVAQMAIESHLTELSINGSDIKIKENQNLLIISNHGKEIM 92  Lactococcus lac...
Q9A1T5         1 -----MIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEMTLNGCHITILRTDRYISIHDDEGEVM 75  Streptococcus p...
WP_012657677  13 ILLESLIALAIMVFIVSLLLSALKQSQKDIALMRHKEEVVATGLMAIQTKQRQLELNGCHVTINSDQGGLSILENDQEIL 92  Streptococcus u...
Q8DS53        93 NL 94  Streptococcus mutans
bgi:05SSU0130 93 SV 94  Streptococcus suis 05ZYH33
Q5M2G2        93 HV 94  Streptococcus thermophilus LMG 18311
WP_014024178  94 -I 94  Lactococcus garvieae
Q9CDU2        93 RL 94  Lactococcus lactis subsp. lactis
Q9A1T5        76 KI 77  Streptococcus pyogenes serotype M1
WP_012657677  93 KI 94  Streptococcus uberis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap