Conserved Protein Domain Family
GAPT

?
pfam11770: GAPT 
GRB2-binding adapter (GAPT)
This is a family of transmembrane proteins which bind the growth factor receptor-bound protein 2 (GRB2) in B cells. In contrast to other transmembrane adaptor proteins, GAPT is not phosphorylated upon BCR ligation. It associates with GRB2 constitutively through its proline-rich region.
Statistics
?
PSSM-Id: 403083
View PSSM: pfam11770
Aligned: 13 rows
Threshold Bit Score: 220.781
Threshold Setting Gi: 1326180272
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_023351531 137 LRKCGNDSGLVLLIVFLLLaILVLGALGLTLFWKh-rH-YISNVALPRFLHKKKDQNEsDSPHIPcTLAEYVDAKSFSPF 214 Tasmanian devil
XP_003310770   2 SKSCGNNLAAISVGISLLL-LLVVCGIGCVWHWK---HrVATRFTLPRFLQRRSSRRK-VCTKTF-LSPRIIGLRHEISV 75  chimpanzee
XP_003782793   2 LKSYGNTSAAILVGAALLL-LVMICGIGCVWHWK---HnDSMRFTLPKVLQRRSSKKK-DYTKTSiLSPRIFGLKHNTSV 76  small-eared galago
EGV92049       2 LRSFVSSSMGVAVGVALLV-LLLACGIGCAWHCK---RqEATAFTLPKFMQRRSSRHK-NFTKNLgLNVHTICPSSKTSV 76  Chinese hamster
Q8CB93         2 LECFESSPVAVAVGVSLLV-LLLLCGIGCAWHWN---RrESTPFTLPKFMQRRSSRQK-DVTKTVsSSAYVISPSMKASV 76  house mouse
XP_007486417 145 CESLK----LEAIIVPLLLvILLLCALGLVWYWKryrYrYSRNFALPKFLHKKRHQNAfDSLRTPhTPTEYGGPKHLTPN 220 gray short-tail...
XP_003408099   2 LKSCGDTSVAFSIGIFLFL-LVVFLGIGCFWHWK---HpDTTRFTLPKFLRRRSSKRN-NYAKTPsLSSQVIGPKHKISA 76  African savanna...
XP_008260459   2 LTSPGNPSVAISIGISLFL-LLVVCGIGCLWHWK---HrDSTGFTLPKFLQRRSSKKK-DCKKMF-LSPHIINAWHKISA 75  rabbit
AAI46051       2 LKICGNTSVAVSIGIFLLL-LLVICGIGCVWHWK---HqNTMRFTLPKFLQRRRSRKK-DYTKTFsLSPQFIGPRHKTSV 76  cattle
XP_013840250   2 LKSCGNHSVGISIGISLLL-LLAICGIGCVWHWK---HcNTMRFTLPKILQRRKSKRK-DCTETLs---QVI--RHRISV 71  pig
XP_023481413   2 LKNCGNTSAAIAIGISLLL-LLVICGIGCVWHWK---QrNTTQFSLPKFLQRRSSRRK-DYTKTVsLSPYVINSRHKISV 76  horse
EFB29490       2 LKSCGNTSVATSIGISLLF-LLLICGIGCVWRWK---HwNPMQFTLPRVLQRRSSRKK-DYTKTLs-SLLAISSRNKISV 75  giant panda
XP_006906105   2 LKSCGNTSMAIPIGISLLL-LLLICGIGCVWHWK---HrNQTQFTLPRFLQRR-SRKK-DYTKTLiLGPHISSSKNKTSV 75  black flying fox
XP_023351531 215 QIKDEPSPLSKGDMDHNYENMAIGSKSCAEECLTDLYENTAQFNSEEHLYGNESSPEYYNFQKPHFPQTPSDVYIYILPD 294 Tasmanian devil
XP_003310770  76 ETQDHKSAVRGNNIHDNYENVEAGPPKAKGKTDKELYENTGQSNFEEHIYGNETSSDYYNFQKPRPSEVPQDEDIYILPD 155 chimpanzee
XP_003782793  77 ETQRCSSTVEGNNIQENYENVQTGPPKAMEETDKELYENTRQSNFQDHIYGNETSSEYYNFQKPSTSQVPQDEDIYILPD 156 small-eared galago
EGV92049      77 ESKGHKSSAKRNRMHGEYENVEVGPPDTKVATEKALYENTQPSNLEEHVYGNQTDALYYNFQKPSPPPVPQDEDIYILPD 156 Chinese hamster
Q8CB93        77 ESKGHKSTAKRNKMHGNYENVEVCPPCTEGTTEKALYENTQPSNLEEHVYGNQTDPLYYNFQKPSPPP-PQDDDIYILPD 155 house mouse
XP_007486417 221 QIKDKPSLLYRNDADQSYENVETGPLRCAEECLTGLYENTNQVNSEEHLYGNESSSEYHNVQKPHLLNYPPVEEIYILPD 300 gray short-tail...
XP_003408099  77 QTQDHRSAMGKTTIHGNYENVEVRPPKAKEETDKEIYENTRQSSFEEHIYGNQTSSDYYDFQEPHTSEAPQDEDIYILPD 156 African savanna...
XP_008260459  76 EVHDHRSAVGETNLNDNYENVEASCPRTKEETDKELYENTRQCDFEEHIYRNETASEYYNFQKPIASRDPQEEDIYILPD 155 rabbit
AAI46051      77 QTQDRHSAGKDTNIHDNYENVKVCPPKAKGETDKKLYENTWQTNPEEHIYGNETPCDYYNFEKPSTSEAPQEEDIYILPD 156 cattle
XP_013840250  72 QTQDHSFSGKDTNICDNYENLEVGPPEIKEKADKELYENTCQTNFEEHIYGNEKPCDYYNFQDPSTFEVSQDEDIYILPD 151 pig
XP_023481413  77 QTQDHRSAVRGTDIHGNYENVKVSPLNAKEETEKELYQNIQQCNLEEHIYGNEAPSKYCNFQNLHTSEVPQDEDIYILPD 156 horse
EFB29490      76 QNQDCRTSGRGTNTHDNYENVERGAPKPKEETDKELYENIRQTSFEEHIYGNEMSSQYYNFQKPSTSEVPQDEDIYILPD 155 giant panda
XP_006906105  76 QSQGHKSAMEETDIYDHYENVETRPPEAKEETNKELYENTRQTNIEEHIYGNETTSEYYNFQKPSTSEVSQDEDIYILPD 155 black flying fox
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap