2CWO


Conserved Protein Domain Family
RSS_P20

?
pfam11757: RSS_P20 
Suppressor of RNA silencing P21-like
This is a large family of putative suppressors of RNA silencing proteins, P20-P25, from ssRNA positive-strand viruses such as Closterovirus, Potyvirus and Cucumovirus families. RNA silencing is one of the major mechanisms of defense against viruses, and, in response, some viruses have evolved or acquired functions for suppression of RNA silencing. These counter-defencive viral proteins with RNA silencing suppressor (RSS) activity were originally discovered in the members of plant virus genera Potyvirus and Cucumovirus. Each of the conserved blocks of amino acids found in P21-like proteins corresponds to a computer-predicted alpha-helix, with the most C-terminal element being 42 residues long. This suggests conservation of the predominantly alpha-helical secondary structure in the P21-like proteins.
Statistics
?
PSSM-Id: 403072
View PSSM: pfam11757
Aligned: 12 rows
Threshold Bit Score: 64.7037
Threshold Setting Gi: 1082475153
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2CWO_A        21 MKFFLKDGETSRALSRSESLLRrvkeLGTNSQ----------------------QSEISECVDE-----FNELASFNHLL 73 
AIA09078       1 MRAYFSVNDYISLSAKVGAVVEr--lCDPSVT----------------------LTEVMDEIND-----SNSFLALVHSM 51  Citrus tristeza...
Q0GK46         1 MRGYYDVQAFKDLNNHYVSCIHvvgaVERRTD------------------------GLKQHCLE-----FNNSLAIKAAL 51  Strawberry chlo...
YP_874193      1 MRACFSIDDMINTISYVTICVAqirrTDVTHSgd-------------------tLNPLIRALND--------SIGTLTAM 53  Raspberry leaf ...
AGW81840       1 MRVIVSPYEAEDILKRSTDMLRn---iNSGVL------------------------NTKECIKV-----FSTITRDLHCA 48  Grapevine leafr...
ACV89928       1 MKFFLKDGETSRALSRSESLLRrvkeLGTNSQ----------------------QSEISECVDE-----FNELASFNHLL 53  Beet yellows virus
YP_008858538   1 MKFFLTTSDRNAAVSRAESVLRevnaLSESSE----------------------ASVVAARINE-----FNELVKFSQLL 53  Carnation yello...
AHA85417       1 MKLYFSLNEYATYLAEICQLSQdmdfTSTEVT-----------------------IPLLDELRLr----FTNLTMKIPSL 53  Carrot clostero...
AHA85427       1 MKLYISIYEYIALVSEISRLLDlvseSEGAIT----------------------YDKFKEFRYR-----FVHLTMLIPSL 53  Carrot yellow l...
AKT94765       1 MKLYIQVKFYESYLKLITDLLEa--iNASNSS----------------------NEKLVEWVTD-----FTDLCSRLQAL 51  Tobacco virus 1
Q5G7F9         1 MKLYFRVAYYESLVTEATNLLTrvrnRDENHD----------------------RAALNKWILD-----FTDLAARVQCI 53  Mint virus 1
OFY20157      46 RKIYQNKEEYINEIVNVCKEENf--pDSIGLEyaneaykylykkygddllyegfKGNLIDSIEIrlilyFVENPKLSDSI 123 Bacteroidetes b...
2CWO_A        74 VTVEHREWMEQHPNQSS-KLRVPSRIGEMLKEIRAFLKVRV 113
AIA09078      52 KSDMNGDHQEGHHEMGEhKSRLLCNIEAKLRVLLDIIRRRF 92  Citrus tristeza virus
Q0GK46        52 KCDANSDVMSRKNSAKE-KLEILTEIDANCAILLKLLRKKV 91  Strawberry chlorotic fleck-associated virus
YP_874193     54 KLDANTTKLCGYYSEASnKLKHCATVEELIREWLFGCRRIL 94  Raspberry leaf mottle virus
AGW81840      49 KASYQWGVDTGLYQRDCaEKRLIDTVESNIRLAQPLVREKV 89  Grapevine leafroll-associated virus 2
ACV89928      54 VTVEHREWMEQHPNQSS-KLRVPSRIGEMLKEIRAFLKVRV 93  Beet yellows virus
YP_008858538  54 NTVEQRERSETQNSLSTnSHGN-S-LSGLLKEIRSSLKVHV 92  Carnation yellow fleck virus
AHA85417      54 KSDLNDCLRDDSIEMYTkKREKLVAFEKTCSEVQTKFRSVI 94  Carrot closterovirus
AHA85427      54 KSDLNDSLRDEGFSMQSeKKEQLVLFEKTCSDVQSKLRRTI 94  Carrot yellow leaf virus
AKT94765      52 KSDVNDAKREESANNLTrKANILKLAGDNLASIRDELRKRV 92  Tobacco virus 1
Q5G7F9        54 KSDVNDAKREESAHDINtKVALLQTFEQRLAEARDVLRLIV 94  Mint virus 1
OFY20157     124 KQYIRNSVKSKEDFKKYlKRRIIKNKDEYITQMITLTRKEN 164 Bacteroidetes bacterium GWF2_33_38
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap