Conserved Protein Domain Family
YgbA_NO

?
pfam11756: YgbA_NO 
Nitrous oxide-stimulated promoter
The function of ygaB is not known but it is a promoter that is stimulated by the presence of nitrous oxide. It is regulated by the gene-product of the bacterial nsrR gene.
Statistics
?
PSSM-Id: 403071
View PSSM: pfam11756
Aligned: 51 rows
Threshold Bit Score: 146.177
Threshold Setting Gi: 503325493
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_008120216             7 KKRLREQKVVGQMIALYCRKNHNTDygmkngashdmshntdgigGKLCDECSALYEYAAQRSRMCPFMEKKTFCSNCTVH 86  [Bact...
Q6AK97                  16 KRIKREKRAVGLMIQLYCRHNHPGH-------------------EGICAECAELLAYAHKRLDGCKYGEDKTTCGKCRTH 76  Desul...
PRJNA61369:DESME_01855   5 SRIEREKQTVGLLIKLYCHDKHHPH-------------------EELCRDCQILFDYAQQRLDHCKFGEDKTVCGDCTVH 65  Desul...
Q5DYZ2                   9 GKLNTEFKTVSAMIEIYCKKHHNAT--------------------HLCEECQQLMDYAEVRLDRCPYGENKPTCNTCPIH 68  Aliiv...
WP_022561209            10 GKLNTEFKTVSAMIEIYCKAHHPQP----------------------CSDCHSLENYAETRLDRCPYGEDKPTCNCCPIH 67  Vibri...
CAV26370                10 GELATEYKTVIAMVHIYCKDHHGAArl----------------dNVLCEECEQLLRYAETRLDRCPYGEAKPTCNKCPIH 73  Vibri...
WP_013560154            13 PRIARERKTILAMSRIYCADHHGLPd------------------GNLCMECQELLDYAFFRLEKCPYQEKKPTCANCPIH 74  Anaer...
WP_014780677             5 rRIIREKKTIAAMMAIYCRDHHATA-------------------GGLCADCAGLLDYAQRRLDTCLFQEEKPACNLCEVH 65  Thioc...
jgi:Despr_1979           8 HRLRREARTVEAMIRRYCRDHHGAT-------------------TEPCPDCRDLLAYAQQRLHHCPFQHRKTTCANCPVH 68  Desul...
AGA31928                26 PRLRREYRTIESMLRIWCADRHGAVgr----------------tSGLCAECMELLAYAGQRLVKCPYGEEKPTCAKCPVH 89  Thioa...
WP_008120216            87 CYKPEMRERIKKVMKFSGPRMLLYHPFMAVWHVVSSRLEKKKDK 130 [Bacteroides] pectinophilus
Q6AK97                  77 CYRPEMRMKICKVMRYSGPRMLFRHPLIALGHIFAGLRKPRDps 120 Desulfotalea psychrophila
PRJNA61369:DESME_01855  66 CYKIEMREKIISIMRYSGPRILFHHPIVAIQHLIDKKAHPPKKN 109 Desulfitobacterium metallireducens DSM 15288
Q5DYZ2                  69 CYKPEPKEQMRLVMRFSGPRMLLHHPILAIRHLLSEKRTVVDKP 112 Aliivibrio fischeri ES114
WP_022561209            68 CYKPEPKEKMRIIMRYSGPRMLLYHPILAIRHLIHEKREVPDLP 111 Vibrio nigripulchritudo
CAV26370                74 CYKPDPKEQMRLVMRYAGPRMLLKHPILAIRHLIHEKRKVPEKP 117 Vibrio tasmaniensis LGP32
WP_013560154            75 CYKPEMRERVRRMMRHAGPRMLLRHPILAIAHLLDGRKKVlppg 118 Anaerolinea thermophila
WP_014780677            66 CYAPLQRERVRVIMRDAGPRMPWPHPILSLGHLLDKWRPAPKLK 109 Thiocystis violascens
jgi:Despr_1979          69 CYKPAQRERIRTVMRHSGPRMLLSHPVLALLHLLDGLRRPRRkp 112 Desulfobulbus propionicus DSM 2032
AGA31928                90 CYKRAQREQVRQVMRYAGPRMLWRHPWQALLHMLDKFRRVEHPl 133 Thioalkalivibrio nitratireducens DSM 14787
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap