Conserved Protein Domain Family
DUF3297

?
pfam11730: DUF3297 
Protein of unknown function (DUF3297)
This family is expressed in Proteobacteria and Actinobacteria. The function is not known.
Statistics
?
PSSM-Id: 403049
View PSSM: pfam11730
Aligned: 31 rows
Threshold Bit Score: 135.466
Threshold Setting Gi: 503980331
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PRJNA213647:NX02_20990  27 PDHLCNDPRSPHYNADVLARGIGIRFKGAERTDVEEYSVSEGWVRVALGKKVDRRGRPLTIKLSGPVEPYF 97  Sphingomonas s...
Q5NLP6                   6 PDHLSVFPDSEWFNADALRRGVGIRFKGQERTDVEEYSMSEGWVRVAAGRSRDRFGRPMTIKLKGEVEAFY 76  Zymomonas mobilis
Q2NDD0                  17 PDHLSVNPRSPAFNAEALQRGVGIRFKGRQRTDIEEYSVSEGWVRVQAGKTVDRKGQPLTLKLKGKVEAWY 87  Erythrobacter ...
Q1GQR5                   6 PDRLSTNPRSPHFDLEVLQRGIGIRFKGKERTDVEEYCISEGWIRVAAGKAKDRFGQPMTIKLAGEVEAWF 76  Sphingopyxis a...
Q21RS9                  26 PDRLSIDPRSPHHVAAVFEHDVGIRLNDKERLNVAEYCISEGWIKVPAGKTLDRKGNPLMITLKGSVQAFY 96  Rhodoferax fer...
CAL62247                11 PDRLSVDPRSPYYDAAIFEHDVGIKLNDKERSDVEEYCISEGWIKVPAGKALDRKGNPLMTKLKGKVEPFY 81  Herminiimonas ...
Q07YF8                  11 PDRLSVNPRSPHHVAAIFEHEIGILFNGKERADVEEYCISEGWVKVASHKALDRRGQPLTMTVKGKVEAFY 81  Shewanella fri...
tigr:AHA_2931            9 PDRLAANPRSPHHVAECFQHEIGIRVNGKERTNVEEYCISEGWVKIPSPKAKDRYGNPMLITVKGTVEAFY 79  Aeromonas hydr...
Q3IK26                  15 PDQLSINPRSKFYVEEVFEHEIGVTLNGKERFDVEEYCISESWIKVAAPKALDRRGQPLLIKVKGTVDVFY 85  Pseudoalteromo...
CCU72098                11 PDHLSSNPRSPHYVKEVFEHNIGIRLNGKERNDVEEYCISEGWIKIASPKALDRRGQPLLMKLKGTVEAFY 81  Thalassolituus...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap