Conserved Protein Domain Family
Tim54

?
pfam11711: Tim54 
Inner membrane protein import complex subunit Tim54
Mitochondrial function depends on the import of hundreds of different proteins synthesized in the cytosol. Protein import is a multi-step pathway which includes the binding of precursor proteins to surface receptors, translocation of the precursor across one or both mitochondrial membranes, and folding and assembly of the imported protein inside the mitochondrion. Most precursor proteins carry amino-terminal targeting signals, called pre-sequences, and are imported into mitochondria via import complexes located in both the outer and the inner membrane (IM). The IM complex, TIM, is made up of at least two proteins which mediate translocation of proteins into the matrix by removing their signal peptide and another pair of proteins, Tim54 and Tim22, that insert the polytopic proteins, that carry internal targetting information, into the inner membrane.
Statistics
?
PSSM-Id: 403038
View PSSM: pfam11711
Aligned: 83 rows
Threshold Bit Score: 415.022
Threshold Setting Gi: 444319746
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011273969  63 NPAFQAMGIPVLRLPSRNWMIFWAVTSGLIGGVLYDKYQQSQIRSKLCERVAKYGAKPLGPNQLSRKITIYIAPPPDDYL 142 Wickerhamomyces...
EEQ40176      36 NPALRAMGIPRISLPSRNWMIFWSVLASIGGGIYYDKQQQKKIREKYMAQVEALSKEVYPTERLPRKVSVFIAPPPNDFL 115 Clavispora lusi...
XP_001383954   1 -----MMGIPRFSLPSRNWMIFWTVLASIGGGIAYDKYEQKQVRKKWMAEVEHLSKQVYPQDRTPRKLTIYIAPPPDDFL 75  Scheffersomyces...
EGW29860      31 NPALRMMGIPRLSLPSRNWMIFWTVLASIGGGIAYDKYQQKQIRAKWMEKVEPLSHVTYTTEKLPRKLTIYIAPPPNDFL 110 Spathaspora pas...
P48990        15 NPALRMMGIPRISLPSRNWMIFWTVVTTIGGGIAYDKYEQKQMRKKWMDAVKQFGEVSYGANEIPRKLSIFIAPPPNDFL 94  Candida albican...
EER31483      15 NPALRMMGIPRISLPSRNWMIFWTVVSTFGGAYAYDRYEQKQIRKKWMEAVQHYGEITYGVDKLPRKLTVYIAPAPNDFL 94  Candida tropica...
EMG45930      15 NPALRMMGIPRISLPSRNWMIFWTVVTTIGGGIAYDKYEQKQLRKKWMDAVKQYGEVTYGADKLPRKLTVYIAPAPNDFL 94  Candida maltosa...
CCE45404      33 NPALRMMGIPRISLPSRNWLIFWSVLVGVGSSIAYDKYEQKQVRKKWMASVSHLSEEVYTNDRIPRKLTIYIAPPPNDFL 112 Candida parapsi...
XP_001523795  38 NPALRMMGIKRISLPSRNWMIFWSVVIGIGSLIAYDKYEQKQIRKKWMESVKHFGDEIYTNERIPRKLTIYIAPPPNDFL 117 Lodderomyces el...
EDK39798      27 SPALRMMGIPRFSLPSRNWLIFWTVLAGIGGGIAYDKYEQKQIRAKWMKHVEHLSQEAYPNDRIPRKMSIFIAPPPDNFL 106 Meyerozyma guil...
XP_011273969 143 DESMAIFRKYVKPILNSGGVDFQIKSENRQGVIRSTVAAEIRELRRNIl------ENE--ENliklqneqkwy-----nr 209 Wickerhamomyces...
EEQ40176     116 DQSMSHFRKYIKPLLNAAAIDFEVYTENRQGDIRSQVAERIRDLRKQTv------EKQ--RQreedakkeaynrswtkff 187 Clavispora lusi...
XP_001383954  76 DESLRLFRKFIKPVLNSASLDYEIFSESRQGDIRQSVAQKIRQMRLDRlds-gvdGVN--GAgansvteetnskt-wtsf 151 Scheffersomyces...
EGW29860     111 DESLKLFKKFIKPVLNASALDFEIFSETRQGDIRSAVAQRIRNLRQAQ-------SEQptEPdvk--------------- 168 Spathaspora pas...
P48990        95 DESLKLFRKFIKPVLNAGVVDFEIFSESRQGDIRASVAEKIRELRRKQlve-etpKKN--ES------------------ 153 Candida albican...
EER31483      95 DDSLKLFRKCIKPVLNAGVLDFEIFSESRQGDIRSTVAEKIRELRRNNipvaeskSEE---------------------- 152 Candida tropica...
EMG45930      95 DDSLKLFRKYIKPVLNAGVVDFDVFSESRQGDIRSSVAEKIREIRRKKaa----vEKE--EK------------------ 150 Candida maltosa...
CCE45404     113 DSSLRIFRKFIKPVLNAGSVDFEIFSEGRQGDIRSSVAQRIRDLRIKElekgkvvKES---------------------- 170 Candida parapsi...
XP_001523795 118 DESMKLFRKYIKPVFNAGCVDFEIFSENRQGDIRASVAQRIRDLRIKAagg-qsnEEK--DAlatsqstttpv------t 188 Lodderomyces el...
EDK39798     107 DVSMQYFRKYVKPVLNAAAVDYEVYSENRQGDIRASVAEKIRELRRERs-----gVEN--TQsdqnsrnnspkd----ml 175 Meyerozyma guil...
XP_011273969 210 fksyfksnkPTKEKIEALESkkftdDLQMQNVLGVyynnihkdd---pikseevdiKDPTLQGGVLCIGRGAYKEYLHGL 286 Wickerhamomyces...
EEQ40176     188 kedvrnlfkKAPKKEEQEVYvsrhdMYTPVDLLGLyrvaepvk-------pvrddenDILHAGGVICVGRGTYKEYMNGV 260 Clavispora lusi...
XP_001383954 152 aggaklfqkSQSGEIEDEQLvkrseLYKPRDVMGLyrvfkpme------evksedeiNPEEAGGVICIGRGAYKEYLAGV 225 Scheffersomyces...
EGW29860     169 ------pvvPVSSGDAEEVLvsrsdLYKAKDVLGLykifpse-------velhpedSDSDIAGGVVCIGRGAFKEYITGL 235 Spathaspora pas...
P48990       154 ---------NGNQDNDEEELksrsdLYKAKDVLGLykvfpadi------nvksedaIDDSSAGGIICVGRGAYKEYLSGV 218 Candida albican...
EER31483     153 ---------KNSQTNEEPEYksradLYKAKDVLGLykvfpgti------eiesedsVEDVSPGGIICIGRGAYKEYMTGV 217 Candida tropica...
EMG45930     151 ---------STSPTTEEPEFksrydLYKAKDVLGLyrifpaei------kiesedaAEDSSPGGIICIGRGAYKEYLSGV 215 Candida maltosa...
CCE45404     171 ---------KSSEIIEEPEYvkrsdLYKPSDVLGLykifpqn-------idtvsddANTDVAGGVVCIGRGAFKEYISGV 234 Candida parapsi...
XP_001523795 189 pvtpftlakNNTPATDSEETvsrstLYKPADVLGLyrifpqkvdivsddstkegmdNDNAVAGGVVCIGRGAYKEYISGL 268 Lodderomyces el...
EDK39798     176 asfkkltggAPKSEDDEEVLvkrsdLYKVRDVLGFyyfndtiy-------phrddelDPEKAGGVICIGRGAFKEYMAGV 248 Meyerozyma guil...
XP_011273969 287 HEGLLGPLEKPldhremedfnksiEPPVVTSIENVESKVENNVETPVDSNtsvsetsvsenkdgsneqseQSEKSNDEts 366 Wickerhamomyces...
EEQ40176     261 QEGLLGPLEKP-------------AEPVPEPAAELPEGENESKAEEVEDF------------------------------ 297 Clavispora lusi...
XP_001383954 226 HEGLLGPLVKPqv---------liEEEEQARIAKEKEKEERIKEGKPAED------------------------------ 266 Scheffersomyces...
EGW29860     236 HEGLLGPLTKP-------------QFVIDEELKAEQELKEKA-------------------------------------- 264 Spathaspora pas...
P48990       219 HEGLLGPLEKP-------------QSVIDEETKLAEEKKKEKEENPDKDD------------------------------ 255 Candida albican...
EER31483     218 HEGLLGPLEKP------------------ENVKEEEEKIELERKKKKEEN------------------------------ 249 Candida tropica...
EMG45930     216 HEGLLGPLEKP-----------------QEIAEEEERRAAEKKKEKEENP------------------------------ 248 Candida maltosa...
CCE45404     235 HEGLLGPLQKP--------------QAIADEEARRAEQKAKDKEENPSKY------------------------------ 270 Candida parapsi...
XP_001523795 269 HEGLLGPLVKP------------------EAIAEEEAKRAEEHANDTSSN------------------------------ 300 Lodderomyces el...
EDK39798     249 HEGLLGPLEAP--------------EPTVEKVSEFKNEDGNSDATVSTET--------------------KAEVAETT-- 292 Meyerozyma guil...
XP_011273969 367 enkENDENSEDKPE-ELPIPKPFISTTDYPNSKLAPElikylnfnqkiptnsqISPFFqQPIAVIPVFFLQGFLNFPIRL 445 Wickerhamomyces...
EEQ40176     298 ---GQKEGAEQKK--QEPVPKPYIQPADYASGTLAPEldftev----irndknVPVLFeQPLSVFAIPKLSGFMNIPRKI 368 Clavispora lusi...
XP_001383954 267 ---LDDDDDEAGTKkLPPVTKSFIQPSEYAAAQLAPElnmani----ilndknVPVVFeQPVYVYPIPKLTGFSKIPQKI 339 Scheffersomyces...
EGW29860     265 ---EQEDSDDEEPN-LKPVPKPWIKPEQYAEASFAPEldisrv----vktsegIPEFFeQPIYVFKVPNLIGFTTIPLKI 336 Spathaspora pas...
P48990       256 ------DNDEEQSN-LKPVPLRYIKPEDYANAQLAPEldlstv----vkddkgVPVFFeQPVYTFPLPNLVGFTNIPRKI 324 Candida albican...
EER31483     250 ---PDDDEDDPNAN-LKPVPLQYIKPKDYAISQLAPEldmttv----ikdkngVPVFFeQPVYVYPLPNVVGFTNIPRKL 321 Candida tropica...
EMG45930     249 ---DKYEDEDEQLN-LKPVPMKYIKPEDYANAELAPEldlsrv----ikddkgIPLFFeQPVYVFPLPNIPGFKNIPRKI 320 Candida maltosa...
CCE45404     271 ---SDDDDDEDNDN-LKPVPMRFIKSSEYANAPLAPEfnldti----lkddkgIPYFFeQPVYVFSVPTIQGFKNVPRKV 342 Candida parapsi...
XP_001523795 301 ---NGDDDDEEKN--LKPVAMKYISGKEYPDSPLAPEfdmsri----vrneqgVPEFFeQPVYVFPVPKVQGFVNIPTKI 371 Lodderomyces el...
EDK39798     293 ---IDEETGETKEE-TNPVPKPFIRPEQYADAELAPEldtsrq----vlndkkVPVLFeQPVYVFALPTIVGFTNTPRKI 364 Meyerozyma guil...
XP_011273969 446 YRFYTRRYYTEEYGKLTVALVENQTRSFNKEtDL-NFAL-DEELEWPKKWVDRAKERQSEWVQELTVDDRVLNKLSVY 521 Wickerhamomyces c...
EEQ40176     369 YRYFNTRKMAEEVSEKTLPIIYGRSRPFEFK-DR-FLGK-EEELDWPKKWVERGRAKNSEWVQELEVDERIANRMRVY 443 Clavispora lusita...
XP_001383954 340 YKYFTTRRLADDFGRRTTSIVYNLSRPYEFK-DT-LSAK-EEEAEWPKKWVAKGIEKNSEWVQELEVDERITDRMRVY 414 Scheffersomyces s...
EGW29860     337 YRYFTKRWLADDYGAKATGVVMNKTRPFTKD-DL-DFAA-DEEKEWPKKWVKTGKERNSEWVQDLQADDRIISRLKVF 411 Spathaspora passa...
P48990       325 YRYFTKRFLVDDFGERTATIVNNKSRPFVYK-DV-LMAK-EEEMDWPKKWVEKGKERNSEWVQELEHDERVTSRMKVF 399 Candida albicans ...
EER31483     322 YNWFTQRFLVEDFGQRTATIVDNKTRPFVYK-DV-LMAK-EEEFNWPKKWVATGKERGSEWVQELECDERVTSRMKVF 396 Candida tropicali...
EMG45930     321 YRYFTQRFLVDDFGERTSNIVNNKVRPFLYK--DtLMAK-EEELNWPKKWVDKGKERGSEWVQDLGHDDRVTSRMKVF 395 Candida maltosa X...
CCE45404     343 YRFFTKRFFADDYGERTTHIVNKDTRPFKEKd---ILMAkEEEVDWPPNWVKRGTERGSEWVQELAYDDRVISRMRVF 417 Candida parapsilosis
XP_001523795 372 YRWFTKRFLADDFGDRAAHIVNMETRPFVYK--DiLMAG-EEEIDWPKNWVKKGLEKKSEWVQELEYDERVTSRLRVF 446 Lodderomyces elon...
EDK39798     365 YRFFNQRYEADDFCRRTAQLVDNKSRPFEYK-DQ-FMAK-EEESEWPKKWVQKGKDKGSEWVQELVVDDRIAQRFRVF 439 Meyerozyma guilli...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap