6ULG


Conserved Protein Domain Family
Folliculin

?
pfam11704: Folliculin 
Vesicle coat protein involved in Golgi to plasma membrane transport
In yeast cells this family functions in the regulated delivery of Gap1p (a general amino acid permease) to the cell surface, perhaps as a component of a post-Golgi secretory-vesicle coat complex. Birt-Hogg-Dube (BHD)4 syndrome is an autosomal dominant disorder characterized by hamartomas of skin follicles, lung cysts, spontaneous pneumothorax, and renal cell carcinoma. Folliculin is the protein from the BHD4 gene and is found to have no significant homology to any other human proteins. It is expressed in most tissues. These same symptoms also occur in TSC or tuberous sclerosis complex, suggesting that the same pathway is involved, and it is likely that the target is the down-stream Tor2 - an essential gene. Folliculin appears to bind Tor2, and down-regulation of Tor2 activity leads to up-regulation of nitrogen responsive genes including membrane transporters and amino acid permeases.
Statistics
?
PSSM-Id: 403032
View PSSM: pfam11704
Aligned: 89 rows
Threshold Bit Score: 154.66
Threshold Setting Gi: 284095502
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6ULG_L       106 YVSHQHPSHPQLFSIVRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRIYLINS 185
XP_009860385 105 FVSTQHPHNPEVFRLVRQACVRSLSCEVCPGREGPIMFGDGQHGYVISYTFYVKDNLARGLQRWYSIICIMKDRVFLIQS 184 vase tunicate
XP_004365251 187 YISSQYPDHPSLYSHVRQACVRSLSCEVCPGREGAVIFGDDKSGYVFSYTFFVRDAQARGFQRWYSIISLMTDRIYLVNS 266 Capsaspora owcz...
EEN51738      54 YVSSQYPEHPQLFSIVRQACVRSLSCEVCPGREGPIFFGDDHWGHVFSHTFFIKDSQARGFQRWYSIIVVMMDKIYLINS 133 Florida lancelet
XP_014350058 106 YVSHQHPNHPQLFSIVRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIIVIMMDRIYLINS 185 coelacanth
XP_005157956  93 YLSHQHPRQPQLFSVVRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDNLARGFQRWYSIVVVAMDRIYLINS 172 zebrafish
EKC37642     101 YISSKQPYDREVYSMSRQACLKSLTGEVCPGKDGPIFFGNDQQGHVLSYTFHINDTQARGSCTRYSILVVMMDKIYLLNS 180 Pacific oyster
EPB91807     155 igTSKSPQQPHLYKAVRLACVRSLTAEFCQGRDGPVLFGDDENGHVMSYMFKLRDAQARGEARFYALMMLMTDRVYLVSC 234 Mucor circinell...
EGD82870     491 YLSEHRPLRSEVYDPLRRACLRAFSSEVTKG--GPVLFGDSQQGFTFSHVFEVKDVSARGGHRRYGILVLVADKLYLASS 568 Salpingoeca ros...
EDV28164      87 YVSRHDPDSPELYTALRHACIRSLSCEICPGREGPVIFGDSFKGYVFSYTFSLKDVEARGQQKWYSIIIVSKDKIFLINS 166 Trichoplax adha...
6ULG_L       186 WPFLLGKVRGIIDELQGKALKVF---EAEQFgcpQR----AQRMNTAFTP----FLHQRNGNA--ARSLTSLTSDDNLWA 252
XP_009860385 185 WPFLVSCIGNIIQYMQSCADSVY---KIESSespQHk--tRMLPRVSNVVtphnFRQHRGHNSn-ARALIQLTGNPELYP 258 vase tunicate
XP_004365251 267 WHFLVSSSRELISDLQKRANHRF---EADQAkktAEarfaSPGVGSGFGMtpdqFRRRRGGHQa-LRSLQDLSGDERLFS 342 Capsaspora owcz...
EEN51738     134 WPFLVKHIGEIISKLQDKAIKVY---DQEQNqcpER----ARRMNESF-MapgdFFRRQRGGDh-FRPLVTLTKDDGLFK 204 Florida lancelet
XP_014350058 186 WPFLLGKIRGIIDELQGKAMKVF---EAEQFgcpQR----AQRMNTAFtp---gaFLHQRNGNa-ARSLTSLTNDENLWA 254 coelacanth
XP_005157956 173 WPFLLRHLRLTIQSLQNTALKVF---DSEQCvcpQR----ALRMNSTFsp---avFPHQRSGNa-ARSLTSLTQHPNLWD 241 zebrafish
EKC37642     181 WPFLVPHLKTVIEHITKKANVVY---EREKIkl---------------pLqppqASRVRSKP---ARSLIDLTDDRNIFK 239 Pacific oyster
EPB91807     235 WPLLVSAFRSMALNLQERANIVF---QREKDgmrQI----TQSSRRAPAMtsqdQFYRRRSNTa-LRSLVDLLGIKDIYA 306 Mucor circinell...
EGD82870     569 WSFLRQHVSVLVRDIVRRAEAASvnlPHSSHlvaG-------ALTSCRRNlpfdRFKSLRDTSd-FLSLIQLLESPLLYS 640 Salpingoeca ros...
EDV28164     167 WNFFTSHIQKVTSDLQSKALKVY---ESEKKqvkR-------NPYRTIALdlgpLSRKRSGTGraTRSLTDILKDSDIFT 236 Trichoplax adha...
6ULG_L       253 CLHTSFAWLLKAC 265
XP_009860385 259 YLHTAFTWIMRAC 271 vase tunicate
XP_004365251 343 TVHTAFAWTLKAC 355 Capsaspora owczarzaki ATCC 30864
EEN51738     205 WLHQWFVWVLKAG 217 Florida lancelet
XP_014350058 255 CLHTSFAWLLKAC 267 coelacanth
XP_005157956 242 SLHSSFSWLLKAC 254 zebrafish
EKC37642     240 ILHLSFVWILKAC 252 Pacific oyster
EPB91807     307 QIQAQFSYTLKla 319 Mucor circinelloides f. circinelloides 1006PhL
EGD82870     641 DIHAYLTWVLKGf 653 Salpingoeca rosetta
EDV28164     237 RLHSYFTWMLKEG 249 Trichoplax adhaerens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap