Conserved Protein Domain Family
UPF0506

?
pfam11703: UPF0506 
UPF0506
This uncharacterized family is found in Schistosoma genomes. Although uncharacterized it appears to belong to the knottin fold. The sequence is composed of two repeats of a 6 cysteine motif.
Statistics
?
PSSM-Id: 403031
View PSSM: pfam11703
Aligned: 3 rows
Threshold Bit Score: 69.9404
Threshold Setting Gi: 353233299
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CDS39701      21 CRKMGEPCSRTVFSRCCEGLYCVLKGFADGTCEKCLPQGHFCFSDGECCSNDCAWYRfCR 80  Echinococcus multilocularis
XP_018653069  26 CRTVGQECSKTVFSPCCENFYCGLNTLFSGQCQPCLAGGYFCWTDKECCSGKCSWLK-CT 84  Schistosoma mansoni
CCD80654      59 CANLTQRCEPTY--PCCSPNLCQVISSEIGTCVECFQLEVDCQYNQQCCSGLCFKNV-CT 115 Schistosoma mansoni
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap