4I2Z


Conserved Protein Domain Family
UNC45-central

?
pfam11701: UNC45-central 
Click on image for an interactive view with Cn3D
Myosin-binding striated muscle assembly central
The UNC-45 or small muscle protein 1 of C.elegans is expressed in two forms from different genomic positions in mammals, as a general tissue protein UNC-45a and a specific form Unc-45b expressed only in striated and skeletal muscle. All members carry up to three amino-terminal tetratricopeptide repeat (TPR) domains towards their N-terminal, a UCS domain at the C-terminal that contains a number of Arm repeats pfam00514 and this central region of approximately 400 residues. Both the general form and the muscle form of UNC-45 function in myotube formation through cell fusion. Myofibril formation requires both GC and SM UNC-45, consistent with the fact that the cytoskeleton is necessary for the development and maintenance of organized myofibrils. The S. pombe Rng3p, is crucial for cell shape, normal actin cytoskeleton, and contractile ring assembly, and is essential for assembly of the myosin II-containing progenitors of the contractile ring. Widespread defects in the cytoskeleton are found in null mutants of all three fungal proteins. Mammalian Unc45 is found to act as a specific chaperone during the folding of myosin and the assembly of striated muscle by forming a stable complex with the general chaperone Hsp90. The exact function of this central region is not known.
Statistics
?
PSSM-Id: 403029
View PSSM: pfam11701
Aligned: 99 rows
Threshold Bit Score: 67.1597
Threshold Setting Gi: 634352831
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4I2Z_A       314 CIDLFLKNLXHxdggiprgwswkfveerg-llalldvasqipelceyPVSAETRQHVAICLQRLEedxvfDT-KRTIFKE 391  Caenorhabditis...
EDO37148     425 CIDALVKVFPKnkllilmfvnmkgvkell-hvaatsallidsgiqslTVTERTRMHISVVLSTIWdsyghDDkQKEPFRN 503  starlet sea an...
Q6DGE9       303 ALNLLTKNVPRqnkkstdnskclftidhglkkilkvcgqvpdlpdqlPMTENTQLIASVLLSKLYddlrcDP-ERDQFRD 381  zebrafish
XP_001942781 305 IIEILTRNVHFnninwaerlidmkglqr--llevaaelietqyeskmEITEYSHTNVSVCLSKIYdnmtcDK-SREKYVN 381  pea aphid
EEB13447     307 ILELITRNVHYtainwaerlveiggvqr--ilkvsshlqefkyesamEITNNTKNIASVCLSRIYenmyyDK-ARQSYLN 383  human body louse
XP_012059041 303 IIELVMRNIHYtaldwaerlvelrglqr--lmevasemeeykyessmNITSSTRTIISVCLAKIYenmyyDA-AKEKFSN 379  Atta cephalotes
EFA05696     301 IIELLTRNIHYtalnwaeqlveiggvsr--lmecaseleeykyesamNITPSTRTIAAVCLSRIYenmyyDA-AREKFMT 377  red flour beetle
XP_002000498 313 VIELITRNVHYtalewaerlveirglcr--llevcselqdykyesamDITSSTSTIASVCLARIYenmyyDE-AKQRFTE 389  Drosophila moj...
Q7QG20       306 IMELLIRNVHWktlnwaerlvelkglmr--lmdvcseleeykyesamNITPSSRTIATVCLSRIYenmyyDQ-ARERFTE 382  Anopheles gamb...
XP_004926897 302 LIELIMRNCHYsainwserfveikglhr--llevcseldeykyesamNITASSRTIAAACLARIYenmyyDQ-AREKFNE 378  domestic silkworm
4I2Z_A       392 KVDXFFNALIsrctnDDEGHKYRIKLSCFLITXLQGPVDIGINLITNDQLTPIXLEXAASQDHLXQGIAAELIVATVSKH 471  Caenorhabditis...
EDO37148     504 DCEAVIGEYM-----KKSSVQSHLEGCTALCALMQGAQDSAAPILKS-GILPLVINLGTMEQRVCKIVSAETLALGTSDK 577  starlet sea an...
Q6DGE9       382 ICDDYIKSKF-----DPNDMDKNIHAINTLSGILQGPFDLGNVLAGRQGVMEMMVALCGSEREVDQLVAVEALIHASTKT 456  zebrafish
XP_001942781 382 AVNEFLKEKL-----LDPDIESKVRAISTITVLLMGPIDVGNSIISRDGIIEMILTMATTNDKVQQKIACECIIAATSKK 456  pea aphid
EEB13447     384 SVEEFIKEQW-----LSPDLDDKVCAISAITALLLGPVDVGNTIIAKEGKIEMILAMAASENVLHQRVACECIIAAASKK 458  human body louse
XP_012059041 380 AIEEFIKDKL-----LSPDIESKIRVVVAITTLLLGPLDVGNAVVAKEGILEMILVMAGTDDVLQQKVACECIVAAATKK 454  Atta cephalotes
EFA05696     378 KIQDFIKDKL-----LTPDIESKVRVAVAITALLRGPLDVGNAIIGKEGIMEMILVMANTDDLLQQKVACECIVAAASKA 452  red flour beetle
XP_002000498 390 QIDEFVKDKL-----LSPDMESKVRVTVAITALLNGPLDVGNQIVAREGILQMILAMATTDDLLQQRVACECLIAASSKK 464  Drosophila moj...
Q7QG20       383 QIADFVKDKL-----LTPDHESKVRVTVAITSLLLGPLDVGNTIVSREGVLQMILVMAQSDNLLEQKVACECLIAAASKK 457  Anopheles gamb...
XP_004926897 379 QVDEFVKDKL-----LSPDLESKVRVTVAITSLLRGPLDVGNYVISKDGIIEMILVMAQTDDLLQQKVACECLIAAASKK 453  domestic silkworm
4I2Z_A       472 ERAINXLKVGIPVLRALYDSEDPT-VKVRALVGLCKI 507  Caenorhabditis elegans
EDO37148     578 VLCSTLGDEGLVALRALYQLRDDE-VRVRALVGLCKL 613  starlet sea anemone
Q6DGE9       457 SKASFFISNGVSLLKEMYKKTKNEkIKIRALVGLCKL 493  zebrafish
XP_001942781 457 SKITPIVKQGTQILKNLYKSGDDD-IRIRALVGLCKL 492  pea aphid
EEB13447     459 DKVSTIVSQGVSILKKLYNSNDDG-IKVRALVGLCKL 494  human body louse
XP_012059041 455 DKANAIISQGVNILKKLYMSKDDS-IRVRALVGLCKL 490  Atta cephalotes
EFA05696     453 DKAKAIIAQGVNILKTLYKSKDDA-IRVRALVGLCKL 488  red flour beetle
XP_002000498 465 DKAKALCEQGVDILKRLYHSKNDG-IRVRALVGLCKL 500  Drosophila mojavensis
Q7QG20       458 DKAKGLVQSGAEILKKLYTSKNEE-IRVRALVGLCKI 493  Anopheles gambiae str. PEST
XP_004926897 454 DKARAILTKGVDILKKLYQCKNDA-VRVRALVGLCKI 489  domestic silkworm
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap