Conserved Protein Domain Family
DUF3292

?
pfam11696: DUF3292 
Protein of unknown function (DUF3292)
This eukaryotic family of proteins has no known function.
Statistics
?
PSSM-Id: 403025
View PSSM: pfam11696
Aligned: 42 rows
Threshold Bit Score: 821.867
Threshold Setting Gi: 927408677
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:MYCTH_103671  30 PTLSHALAAET----RGAQGPAQPNNNNS--SVVDLGWNEKKENIAASPIEGMTNEELWLLVRRFNK------------- 90  Thermothelo...
GAD96737          42 PTDSHALAKEQvhpdQDEKGIVQKAGATT--GLMDVGWNRRPDDVESPLVAGWSNEDLWMLIRRFNKvcisdhgaartel 119 Byssochlamy...
EED53680          14 DTDTHDHALLA----PGESNAVQKVNNNG--KQSDVKWKQASKIVDEQLMPDLSNEDLWLLVRRFNK------------- 74  Aspergillus...
Q0CAX6            13 DTESHDLVQVE----ADEPGPLQTPVSNG--KALDITWKSSSRTIDEDLVSGLSNEDVWMLIRRFNK------------- 73  Aspergillus...
CAP80880          23 nDESHDLTQVP-----EEAGPLQT--LSP--RPPSTQWKASSRNVDETLAKGLSNEDLWMLIRRFNK------------- 80  Penicillium...
XP_002563473      35 PTESHVLSQVE----QDEKGLSQKAGDTT--ELTNIGWGGSPGATEEPLVAGLSNEDLWMLIRRFDK------------- 95  Penicillium...
Q4WYE6            35 PTDSHVLSQVKp--eEEDRGLAQKAGVTN--DVSDIGWGES-DKIEERIVTGLSNEDLWMLIRRFNK------------- 96  Aspergillus...
Q5BCV5            44 PTDSHILSQTKpq-dNEAKGLAHRAGENEpgQVSDIGWGSS-DTVQERVVPGLSNEDLFMLIRRFNK------------- 108 Aspergillus...
XP_001400008      37 PTDSHVLSKVD----QDDKGLAQKAGQTD--TVTDLGWNQHADELDEQLVSGISNEDLWMLIRRFNK------------- 97  Aspergillus...
Q2UBV5            40 PTDSHALSQID----HDEKGLAQKAGDTD--EVTDVGWGHSPQG---RIVAGLSNEDLWMLIRRFNK------------- 97  Aspergillus...
jgi:MYCTH_103671  91 ----QIYNVKATPYPPPGGLDLNIAEDEEFSPDKLRANIERLYMTVGVGLLAASKHVARLRSWQERRRTTYLAG------ 160 Thermothelo...
GAD96737         120 ihwqQIYRVKAVPDPPMAALDLNVADDEEFSPDKLRNKLERLYVTVIVSLIAAGKHIVRLRSWREPRRTAAFCV------ 193 Byssochlamy...
EED53680          75 ----QIHHVKAIQGPPQDELDLNRADEEQFPPEKLRATTERFYTSVVVGLVNIFSHVTRLRSWKEPRRTTAFCI------ 144 Aspergillus...
Q0CAX6            74 ----QIYYVKAMSDAPAGELDLNRADDEQFPPEKLRMTLERFYMSVLVGLSYFSKHIARLRSWKEPLRTLLFCT------ 143 Aspergillus...
CAP80880          81 ----QIYHVKAVHDTASLNLDLNRTENEQFPPEKLRITLERFYTSVVVGVTEFFRHITRLRSWKEPVRTTIFCA------ 150 Penicillium...
XP_002563473      96 ----QVYRVKAVPDAPVQRLDLTRKDDDEFSPDKLRATLERFYTTVIVGLTNCIKHIARLRSWKEPRRTAAFCMa----- 166 Penicillium...
Q4WYE6            97 ----QIYCVKAVPNPPLQRLDLNRAEDENFSPDKLRATLERFYTTVVIGLTSLVKHIARLRSWREPRRTAAFCAteqyiq 172 Aspergillus...
Q5BCV5           109 ----QIYNVKAVPDAPLQGLDLVRAEDDHFSPDKLRATLERFYTTIIIGVTAF--HEGR---ADQDVQ------------ 167 Aspergillus...
XP_001400008      98 ----QIYYVKAVPDSPLQRLDLNRAEDEQFSPDKLRATLERFYTTIVVSLTSFVNHIARLRSWRERQRTAAFCA------ 167 Aspergillus...
Q2UBV5            98 ----QIYYVKAVPDAPLQRLDLNRAEDEHFSPDKLRATLERFYTTIVVSLTAFYKHIVRLRSWREPRRTGLFCG------ 167 Aspergillus...
jgi:MYCTH_103671 161 AYFVAWAFDFLMPLLSVVVLALIGFPRARELLFPPAPLALVDSkTGGIQKPKAGVL--GSHDSATGALENHKGEAVEQEA 238 Thermothelo...
GAD96737         194 VYFLAWLLDLLTPTLLGTLLVLILYPPSREVLFPPAPLALVDSkTGSVQTPKAGVL--GSHDSVTGAPEKYRGEAVEQEA 271 Byssochlamy...
EED53680         145 TYFVAWFLDLLIPVTTGVLVALILFPSTRSLLFPPR----ITSgDGS----DAGSVeqSTRDSITNSPETYKGEAAEQEA 216 Aspergillus...
Q0CAX6           144 CYFVAWFQDLLIPAISGFFATLILCPSIRTWLFPAASRAV--SdDEGAKSGEDT----TSQDSITGAPERYKGEAAEQEA 217 Aspergillus...
CAP80880         151 CYFAAWAVDLLVPTISGLVVALIMVPPVRQLLFP----GLAKAdDSNGIIPTEGEV--QSEDSLTGAPENHKGEAAEQEA 224 Penicillium...
XP_002563473     167 CYALSWLLDLLVPTMLVTLLALVIYPPCRSLMFPPAPIPLVNKdTGGVQKPKAGIL--GSDDSITGAPEKFKGEAAEQEA 244 Penicillium...
Q4WYE6           173 VYSVAWLLDFLVPTLFGTMLVLVVWPQSRKVLFPPAPLALVDKsTGGVQKPKAGVL--GSHDSVTGAPEKYKGEAAEQEA 250 Aspergillus...
Q5BCV5           168 VYFTAWLRDLLIPTIFTTLLTLVLYPPSRKFLFPPAPIALVDTsTGGVQKPKAGVL--GSHDSMTGAPEKYKGEAAEQEA 245 Aspergillus...
XP_001400008     168 VYFAAWALDLLAPTIFTLLIVLVISPDSRSYLFPPAPIALVDKdTGGVQKPKAGVL--GSHDSITGAPENMKGEAAEQEA 245 Aspergillus...
Q2UBV5           168 VYFLAWLLDFLVPTIFCFLITLVVYPPCRIWLFPPAPIALVDSnTGGVQKPKAGVL--GSHDSVTGAPEKMKGEAAEQEA 245 Aspergillus...
jgi:MYCTH_103671 239 SNFVSGIASVAMSSAA--YSDEDPG-----ADTALDPTALATKTADARDKAGGEETGAKHDKTKVPMEKVMWNKMRPVMH 311 Thermothelo...
GAD96737         272 SNLVSGVASVAVGSAVgkHDQGTPEda-piEGSAPDPTDVVASSADAASAGQGAVPSDAHDKTREPMKKEVWEKVKPVMR 350 Byssochlamy...
EED53680         217 SNLVNDIANIAMESARgkYGQSVIDdddaeGSSEPEPVDVGAITADVQAENA-----PVEDKTKKPMKKKISKATNQTMR 291 Aspergillus...
Q0CAX6           218 RNLVNSVANVAMESAAakYGQGISN--------EESDTASELNMEDVGVKAEEAGENEIPDRTKRPMKKKIGKATDKVMF 289 Aspergillus...
CAP80880         225 KNLVDSFATVAMESAAakYGQTVPE-------DAPDRPALIESLEAAEAAAGTPTGDSPEDKTKKPMKKKVSHATDNVMR 297 Penicillium...
XP_002563473     245 SNLVASVASVAVGSAVgkHDQGVPDda-plEEDVPDAMDIVATTADAQSAAHGKVPADSHDKTRQPMKQSVMDAANSSMQ 323 Penicillium...
Q4WYE6           251 SNLIASVATVAVGSAAgkHDQGTPEda-pmESSVPDAMDIVSKTADAQAAAGGEVPADTHDKTRQPMKETVLNGANLAMR 329 Aspergillus...
Q5BCV5           246 SNLMAGIATVAVGSATgkHDQGNPEga-pmESKVPDATDIVAKSADAQAAANGEVPAETHDKTREPMKQTVLNSADQAMR 324 Aspergillus...
XP_001400008     246 SNLFTSVASVAVGSVAgkHDQGTPDda-pmEENVPDAMELATSAADAQTAAHGEAPDDAHDKTRQPMRDTVYNAANKSMR 324 Aspergillus...
Q2UBV5           246 SNLIASAATVAVGSVAgkHDQGTPEga-pmEDSVPDAMHTVAEAADAQTAAHGGVPDSTHDKTREPMKETVLNGANIGMR 324 Aspergillus...
jgi:MYCTH_103671 312 TIGTVADTWERLANALSPIPLFPSEVYRLRLVAILLPLLLgSSLFLTPYLVLKLLSFLAGAVFFGDPVISRCLDWLNRTI 391 Thermothelo...
GAD96737         351 ILNDVCDTWEKLENALSPKPPFSRYAP-LRLAGILLPAFL-GSLVTSSYIFIKMSTLFVGFGFFGDPIISRGMAMLNHRF 428 Byssochlamy...
EED53680         292 ILGDITDIYEQFSNILSPTPPFLAIAPRLQLVGMLISIAL-ISLVTSSHFMIKSGSFLLGLAVFGDPVLQRTIAFLNDKV 370 Aspergillus...
Q0CAX6           290 VISDITDIWEKFSNILSPTPPFYGVTARLRLLGILAGISV-SSLVLSSHFILRTVSFLAGVVFFGGPIFQWTISFLNERV 368 Aspergillus...
CAP80880         298 VLSDITDIYEKFANILSPTPPFFLVTSRLRLASIFTLVSV-IVPFTSSYWIIKLVGFALGLGFFGDPIFTYTLDLLDTKV 376 Penicillium...
XP_002563473     324 MISDITDTYEKFGNALSATAPFPQLSPRLRLMAVLGPAFL-ISMGTSCYVFMKLSTLLIGLAFFGDPVIRRGIVYLNRRI 402 Penicillium...
Q4WYE6           330 VLSDIIDTYERFGNALSPTPPFPASTPCLRLSSVLVAGFL-GSLPTSSYVFVKLGTFLFGFVFFGDPVLQRFINYLNHAF 408 Aspergillus...
Q5BCV5           325 VMADVIDTWERFANALSPTPPFSMMTPRLRLAGVLASGLL-VALLTSSYVFMKIATFSVGLAFFGDPLIQRGIQYLNREY 403 Aspergillus...
XP_001400008     325 VLSDIIDTWERFGNALSPTPPFSIVTPYVRLTAVLSVGFL-VSLLTSSYVFVKMITFGTGFAFFGDPIIWRAVTYLNREY 403 Aspergillus...
Q2UBV5           325 IMSDITDIYEKLGNALSPTPPFSSTTPYVRLASILSLGLL-GSLITSSYVFVKMGTFVVGFGFFGDPVLARLTAYLNRKY 403 Aspergillus...
jgi:MYCTH_103671 392 PNWPELLQPRNTILNGVPTNAQLTLTLLRHGEVNHAPLpPPPPPSprvTPPPPDKPAA-LSDGDLRAeAGGD-SPLGvSN 469 Thermothelo...
GAD96737         429 PHWQKLLELQNTLLKGIPTNAQIAITLLRIGEANGAPL-PPPPGSe--LEKVPSRPAS----------LNKDeIPLD-AS 494 Byssochlamy...
EED53680         371 ANWKEYLDLQNTLLKGVPTNAQLTLALLRLGEINSTPL-PPPPTS---HNNEPLWPIRkPFGSITSGkNKDE------PS 440 Aspergillus...
Q0CAX6           369 PNWKQQLDLNKTLLKGVPTHAQLTLTLLRIGELNSSPL-PPPPSS----KEEPAWPLRrKKTKPAISdKPANaDP---AS 440 Aspergillus...
CAP80880         377 PNWKDHLDLQKTLLAGVPTNAQLTLTLLRIGEINSSPL-PPAPSS---DDNEPVWPIRrKKSQA--------------AS 438 Penicillium...
XP_002563473     403 PNWQKLIQLQNSVLKGIPTNAQLAITLLRIGEANASPL-PPPPTS---QDKVPSRPAS----------LNQEeLNLG-AT 467 Penicillium...
Q4WYE6           409 PHWQKLLNLQNSLLKRVPTNAQLTLTLLRIGESNAAPL-PPPPSSs--LHKAPSRPAP----------IHHDqLALG-AS 474 Aspergillus...
Q5BCV5           404 PHWKELSQLQNTLLKGVPTNAQLTLTLLRIGEANAAPL-PPPPSGs--VEKAPSQPAS----------IDHDtLKLG-AA 469 Aspergillus...
XP_001400008     404 PRWEKLLELQNSLLKGIPTNAQLTLTLLRIGEANGAPL-PPPPSHs--LHQTPNHPAP----------VDDKdINIP-AS 469 Aspergillus...
Q2UBV5           404 PGWIKLLELQNSLLKGIPTNAQLTLTLLRIGEKNAAPL-PPPPADs--LNKAPSHPAS----------LNPSqVNLD-AS 469 Aspergillus...
jgi:MYCTH_103671 470 TAELDSAITYDPSTIPHETNNttgpenhaavrGERDRDRdRDrdSagsgattskhghghGHGHRILGFFKgGTTRGAVKT 549 Thermothelo...
GAD96737         495 NHEIEQAATGQTAEAKQITGDd----------QKPQQEGkQK--K--------------GFMSSVVGFFR-GTTAKGVET 547 Byssochlamy...
EED53680         441 SALISQTPSPKLELSKAEAR------------------------K--------------KKWSKILKFIG-RTIATAMKG 481 Aspergillus...
Q0CAX6           441 PLEVDGTALDEATSPVSPKKS--------------------K--R--------------RWVSKVLKFVG-RTIATAIKG 483 Aspergillus...
CAP80880         439 STDVSRQGSSVDLQSTNSTES-------------LPETKvPK--K--------------RFVFKLLKFFK-RTISTAIKG 488 Penicillium...
XP_002563473     468 DEEIKQAALVKPEDHAQEAQA--------------SPEKgHK--R--------------TLGSSILGFFR-GTTASGVES 516 Penicillium...
Q4WYE6           475 TEEISRAAAPEPKQDAAQEPH--------------KDEEpKK--K--------------SLGARIVGFFK-GTTATGIEA 523 Aspergillus...
Q5BCV5           470 PNEIDRAAAPEPEHPNMHQQE-----------KAEFEKPkQK--K--------------GFGAKLLSFFR-GTTAAGIES 521 Aspergillus...
XP_001400008     470 EEEINQAIAPSPQPVVEEHEV---------------HPKpPK--K--------------GFMNRMIGFFR-GTTATGIQS 517 Aspergillus...
Q2UBV5           470 EEEITQAAAPDPIAQAQEEEE-------------KSRAKkPK--K--------------TIGSRIVGFFR-GTTATGIES 519 Aspergillus...
jgi:MYCTH_103671 550 AVGADKLRAKTpGSAGARdHRLGVLAPgrrsgagggqqQeghGPVPaGAGPAEFEARWEGHRGRVYVSaSGATVPVVAFG 629 Thermothelo...
GAD96737         548 KLAVDRVKASV-GSKNAK-NHIGVLPL-----------Kg-qRPAP--GGPVEFEARYKGKHGAIVVD-TSQKPAVVYFT 610 Byssochlamy...
EED53680         482 HIAFDRAMRIT-ESANTK-NLIGLLSR-----------Rg-wITAP-PVGPLKFEAKFERKRGTVVID-SSQEQPVLYFT 545 Aspergillus...
Q0CAX6           484 HIAIDRAMAIA-GSEHTK-SLISLLSK-----------Rg-wVTAP--FGPLKFDAKFERKRGAVVID-SSLEPPVLYFT 546 Aspergillus...
CAP80880         489 HIAFDRAMAIA-GSAHTK-NLIGMLQN-----------Gh-fAATP--FGPLKFDAKYERKRGAAVID-SSKEPPILYFT 551 Penicillium...
XP_002563473     517 KRGIDRLRAAI-GSHHAK-NRVGVLRD-----------Rg-kRITP--AGPVAFDARFDGKRGTVIID-STKEPPLLYFT 579 Penicillium...
Q4WYE6           524 KLAVDRVRAQA-GSTHAK-NHVGILRK-----------Kg-eETLP--YGPVEFDARYKGKRGNVVID-SSKQPPLLYFT 586 Aspergillus...
Q5BCV5           522 KLAISHARAEI-GNLHAK-NQKGVLRK-----------Kg-lETLP--MGPVEFDARYQGHRGMAIID-SSHEPALLYFT 584 Aspergillus...
XP_001400008     518 KLAVDRARAAA-GSKHAK-PRVGVLRS-----------Kg-kVTLP--SGPIQFDGRYKGKRGVVVLD-QSQKPPLLYFT 580 Aspergillus...
Q2UBV5           520 KLAVDRVRAAA-GSDHAK-SRLGILSR-----------Kg-kRALP--SGPVRFDARYKGNRGAVVID-SALDPPVLYFT 582 Aspergillus...
jgi:MYCTH_103671 630 KSspstttttssaagrggaagggtgtvgeeEELRPMWSVPAAEVVEMLKIGGYAWKAKLVVGWSM--GTEVKDGLVIRTV 707 Thermothelo...
GAD96737         611 TKplpqsel---------------pdskqrNEKEILFTVPIDDVQELKKVGGMGWKGKLVVGWAEr-QKEVIDGLIITGS 674 Byssochlamy...
EED53680         546 TCqsakldd---------------lrlenqKKSAVLFQIPINEIKELKKTEGLGWKGKLIVELTAg-TKDSIDGLVISRM 609 Aspergillus...
Q0CAX6           547 TYqserldd---------------lrlecrKKGSVLFQIPVTDITELKKTEGLGWKAKMIVELAAg-SKEAADGLVISGK 610 Aspergillus...
CAP80880         552 TYqssgldd---------------lriesrKKGSVLFQIPVTEIKELKKTEGLGWKGKLIVELTAg-SKEAADGLVVNGD 615 Penicillium...
XP_002563473     580 TDipqhgd----------------ahlesrKVGSVLFTIPVTDIQEMRKLGGMGWKGKLVVGWALg-SKEVVDGLLITGT 642 Penicillium...
Q4WYE6           587 TDptviqgd---------------yrldsrKKGTVLFTIPVTEIQEMRKIGGMGWKGKLAAGWAVg-CKEVVDGLVIIGE 650 Aspergillus...
Q5BCV5           585 TDetaqlgd---------------yrmesrKNGSVYFDIPVSDIKEMRKIGGMGWKGKLVTGWAVg-GKEVVDGIVVKGN 648 Aspergillus...
XP_001400008     581 TDqtvqldq---------------pslehrPKGTVLFKMPVTDILEMRKIGGLGWKGKLVTGWAVgsSKEVVDGMVLTGK 645 Aspergillus...
Q2UBV5           583 TDpdalldd---------------qrlesrEKGTVSFTLPVTDIRELRKIGGLGWKGKLAAGWAVe-SKEVVDGLEIVGK 646 Aspergillus...
jgi:MYCTH_103671 708 --AGDEYKITAVPMRDELFNQLIALGGQKWEA 737 Thermothelomyces thermophilus ATCC 42464
GAD96737         675 d-SKQSYHVTAMKSRDYLFNRLIAINGQVWQT 705 Byssochlamys spectabilis No. 5
EED53680         610 epQYQSYHVTGMRGRNQLFNRLIAMDAQFWES 641 Aspergillus flavus NRRL3357
Q0CAX6           611 e-PEQSYHVTGMRARNQLFNRLVAIGSQFWES 641 Aspergillus terreus NIH2624
CAP80880         616 e-LGQSYHLTGMRSRNQLFNRLVAIDAQFWES 646 Penicillium rubens Wisconsin 54-1255
XP_002563473     643 k-PEQSYQLTAMGTRNQLFNRLIAIDGQVWAS 673 Penicillium rubens Wisconsin 54-1255
Q4WYE6           651 h-PHDSYQLTAMSTRNELFNRLVAIDGQVWES 681 Aspergillus fumigatus
Q5BCV5           649 h-SHQEFQLTAVTKRDELFNRLVAIDGQVWNS 679 Aspergillus nidulans
XP_001400008     646 l-PEQKYQLTAMKTRNQLFNRLVAIDGQVWES 676 Aspergillus niger CBS 513.88
Q2UBV5           647 deKKQHYQLTAMKTRNQLFNRLVAIDGQVWES 678 Aspergillus oryzae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap