Conserved Protein Domain Family
DUF2990

?
pfam11693: DUF2990 
Protein of unknown function (DUF2990)
This family of proteins represents a fungal protein with unknown function.
Statistics
?
PSSM-Id: 403022
View PSSM: pfam11693
Aligned: 10 rows
Threshold Bit Score: 65.8852
Threshold Setting Gi: 242773773
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAP93951       8 VCLAAISLAAPTh-FLDDAYDWSDELAEFYGKVSQYINTA-RHNIRVPGACEASKIALPSYASGM 70  Penicillium rubens Wisconsin 5...
CAK44123       9 GCLTAGSMAAPT--LLNDIYDYSSDLATYLGKVSKYIESTgEELIKSANSCDTSKISLPSYASSL 71  Aspergillus niger
Q5BFE4         8 SCLAACSAAAP---IFENFYNFSDDMAEFLGRVSKAIHSE-----VNSLTCDTSSIALPSFASGL 64  Aspergillus nidulans
Q2UCV4         9 ACITAYSFAAPA--FFDNAYNFSNDLSECLGRVSKHIEHS-KD-ILNTATCDTSSVELPAQASGL 69  Aspergillus oryzae
XP_001268836   9 AWLTASAGAAPT--LFDNTYDYSDELGEFYGRVSKYIDSA-KDAFAASMSCDTSRIALPAFASGL 70  Aspergillus clavatus NRRL 1
Q0D0A8         9 AGLMATSLAAPT--FFDDLYDYSDDMAGFLGRVSKHIEDA-KDLFTATSTCDPSNIALPAYASGL 70  Aspergillus terreus NIH2624
Q4WS27         9 TWLMGTAYAAPA--FFDNIYDYSDELAEFYSKVSKYIDDS-KDVLTATTTCDPSKISLPAFASGL 70  Aspergillus fumigatus
EKV10298       8 ICFAAISLAAPTn-FLDDVYDWTEELSEFYGKVRQYIKNA-KYNIRAPGACEVSKIALPSYALGL 70  Penicillium digitatum PHI26
XP_002478307   9 ASLATAAVAAPTsnVFNDVYNFDATLEEFYSRVSAHIGRF-ADG-PPPTNCDLSKVSVPS--SSL 69  Talaromyces stipitatus ATCC 10500
EPS25354       8 lsLATVSLAAPAn-YFDGVYEFSNELADFYSKVSMYINRI-QQSTSPSAICDTSKITLPSYASew 70  Penicillium oxalicum 114-2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap