Conserved Protein Domain Family
DUF3278

?
pfam11683: DUF3278 
Protein of unknown function (DUF3278)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 371668
View PSSM: pfam11683
Aligned: 8 rows
Threshold Bit Score: 108.175
Threshold Setting Gi: 145690208
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014940354           1 MRQDDTISTKLFRYFFHIRGVLDKAARQQMNAAISKAFLFMWLYILVFTGGVLLFVKNTPNSESWmLFVY-LSLLIGVGG 79  Lactoba...
cebbi:LBUCD034_1838    1 MKAKESFGSRLLMHWFGVKRPFDEYKHQQIGRIGTNAYMILAVYLLVSSIVAIFVGQKHPEEALI-GLVM-INIVMVGFV 78  Lactoba...
Q03TZ7                 1 MTNQESLWDKIVKHFYRISGNFDEYKRQEVNRIGNNAFMISWPILLIAPVVACFWAESSPENALL-GLIL-TNFFYFTLV 78  Lactoba...
cebbi:LBUCD034_1840    1 M--KESFLIKIMRYFFSIRGVLDEHNAREIGKVATNAFMFLWMYTGIANAVFLLLPQAIKTGSMInGFIL-FNMFIVWGG 77  Lactoba...
jcvi:HMPREF9243_0020   1 MRKKNSLYIRFLKFFYGVE-EMDEYRLVQCERMGNKCFIFIWLWEAILFLLALFFP--AEKSLIAfNFIL-WGSLFGIVM 76  Aerococ...
bgi:05SSU1748          1 MK-KETFQDKLIKRFYGIAGPLDEFRQKEASRLGNTCFILLFWGTMALTLLALALSKRYPE---VvAYGYpTALLLSTLS 76  Strepto...
KRK50799               1 M--KESIGTKIFKQFYNISGPIDEYKKTQANTIGNTVAIMLYWFNIAISLLTIIIGGVTKNYLLAfFILSgTILIFTIFI 78  Lactoba...
jgi:Lreu_1815          1 M--KETISTKIIKWFYGIHGPLDEYRRNELNRIGNNIAIFLLSINLLLSFIASLLMLNTNNSELTlDIVV-SVLLLTVFA 77  Lactoba...
WP_014940354          80 SGLYIRRRAADLGLDIRKVIANQYDDAVEDAVMGSVWVGFLGGVVLFA 127 Lactobacillus buchneri
cebbi:LBUCD034_1838   79 VNIYILIATTRAHIVTREIQAASRQEIIKKAVLKGIGFGIYFMVIMLI 126 Lactobacillus buchneri CD034
Q03TZ7                79 VLPYIAWASRQAGLATHEISYQDRHAAYRHIFWVSVGQALYFFILESL 126 Lactobacillus brevis ATCC 367
cebbi:LBUCD034_1840   78 VGLYVTHKVSELKLNYQEVSTKEYPKAVHKAVIHGAWFGISYGLVTYL 125 Lactobacillus buchneri CD034
jcvi:HMPREF9243_0020  77 TMVYILIFSMKLGIMVKEIDASDYPANKKRIRKKVTKSSLIYGIILFL 124 Aerococcus urinae ACS-120-V-Col10a
bgi:05SSU1748         77 SSMYMTSKMRHSQVDSLDVEELT-TKEQKQLKGASIKFALYFTAVMYI 123 Streptococcus suis 05ZYH33
KRK50799              79 AGGYVMYAGHKYHLADQEVEKGDIHSAYRNIIFKSLKIGILGAIFAYF 126 Lactobacillus reuteri DSM 20016
jgi:Lreu_1815         78 SSGYILYETKRHHLTEIDVEAKQEGKTKQKFIKRAIVLGIYFAFIIYG 125 Lactobacillus reuteri DSM 20016
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap