Conserved Protein Domain Family
DUF3275

?
pfam11679: DUF3275 
Protein of unknown function (DUF3275)
This family of proteins with unknown function appear to be restricted to Proteobacteria.
Statistics
?
PSSM-Id: 371666
View PSSM: pfam11679
Aligned: 9 rows
Threshold Bit Score: 253.942
Threshold Setting Gi: 500119781
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011804693   14 IVVPG-QLTLRTIRGKNGPFTVGRLATHLGTFEVKDPELEQYPEGKYDGEFVIRYIFPKSYPV-GGGMRFEIRASLDGMT 91  Proteobacteria
WP_011795786    2 IKLSGvTLRVKKMTGRNGDFCVADLQSDIGEFKVKDALLDQFDDGEYTGTAWITEIYLAQYIS-FGKGVTEIRARLHDLQ 80  Acidovorax cit...
CBL47122        1 mlING-TLLVQRINGTHGSFSVGKIECEFGILNIKDPHLDQFDSGKYPGRFNVERIFPIGYMTrTGAFIVEIRAKVTDYL 79  gamma proteoba...
DSC:DSC_04200  12 IIVPG-QLKLRTIRGRHGPFNVGLLACPLGEFVVKDPEFEQYKEGKYDGEFAIGRIFAKSFVS-LGGVRVEIRASLNGMT 89  Pseudoxanthomo...
WP_003296475   12 liVRG-QLAIRTIPGRNGRFTVGRLTTRLGLFHVKDPELEQYPEGKYEGEFVIRYIYPKAYPV-GDGMRFEIRANLDGMT 89  Proteobacteria
Q5P5B7          2 ITIPG-QLAIKTIHGRNGDFNVGRLETSIGEFVVKNAELDQYAEGKYEGDFVIAEIRPSTYTA-NGRMVIEIRALLGGMT 79  Aromatoleum ar...
jgi:Tgr7_2832   2 ITLPG-QLAIKTIHGRNGDFNVGRLATSIGEFVIKNAELDQYREGKYEGDFVITEIRPSTYNT-SGRMVIEIRAHLGGMT 79  Thioalkalivibr...
CAP41650        2 ITLPG-QLAIKTIHGRNGDFNVGRLTTSIGQFVIKNAELDQYGEGKYDGDFVIAEIRPSTYNT-SGRMVIEIRAHLGGMT 79  Bordetella petrii
WP_011062940    2 ISITG-QLAIRTISGRLGLFNVGRLSTSIGEFTIKDALLDQYQEGKYRGDFAIKQIRPSYYSH-GGRLVVEIRAELEGMT 79  Pseudomonas pr...
WP_011804693   92 LNGidklSRDEA----RSFATQDVDPLDEEQGAqp------aATPAKPAKASRPa--kPAPVQASADPLVDT-TPFGVDA 158 Proteobacteria
WP_011795786   81 LDG----ARERP----RDTEPQEPDPADELVAQ---------AAPAAALVASPS----PAPASSRLSKLRDRlSAVGKKA 139 Acidovorax cit...
CBL47122       80 F------SADEPgmldSSIALTEIDPLESHSAQavailppapEKPAAPILQKAV----PEKAATPKAPVVDT-E---MKA 145 gamma proteoba...
DSC:DSC_04200  90 LSGidklGREEA----RNFNVQEVDPIDEDQPAta------vATPTAASAL------------SSNDPLIDT-RPFGMDA 146 Pseudoxanthomo...
WP_003296475   90 LSGidklSKAEA----RAFAAQDVDPLDEELGTpp------aTTPAAAEKSKSRskpePAPVQASKDPLVDT-TPFGVDT 158 Proteobacteria
Q5P5B7         80 LSNidalSRDEA----HRLSPQEVDPIDEEAQTpa------pAAPKVPAKAKSR---------SLRDPLIDT-TPFGRES 139 Aromatoleum ar...
jgi:Tgr7_2832  80 LSNidhlSRDEA----NRLSPQEVDPIDEEAQRp-------vPSTSAPAEAKAA---------TSSDPLVDT-TPFGADV 138 Thioalkalivibr...
CAP41650       80 LSNidslSTDEA----QRLSPQEVDPIDEEAQAp-------aAATRPPARTRSR---------TTRDPLVDT-TPFGSE- 137 Bordetella petrii
WP_011062940   80 LEDvtglSREDE----EHLPTNVPDPLEEDGp---------pSTPIPPRRNPST-----AVRQPQSDALASD-EPFGMNS 140 Pseudomonas pr...
WP_011804693  159 PPPAAAAAPGSTEDGD---AALFGLLWP---LGESVKLDSTI---DRRTLRAQIARLGELGYALDFKTQEWSR 222 Proteobacteria
WP_011795786  140 STPAPEPTEGRDDGREremEALFGELWAsikAREPVKLDPTV---ERSVIRAQSAAIRQLGYSMDPIKQMFVP 209 Acidovorax citrulli
CBL47122      146 PCTVPVIAPPKPPATDp-vAELFGELWP---LENRVRLDPTTvrsDGENHRKRCMYLKQQGYKFRASSQTWER 214 gamma proteobacterium...
DSC:DSC_04200 147 --PATVTAADGPDAED---AALFGLLWP---LAETFKLDSTI---DRRTLRLQCARLNKLGYSFDATSQQWQR 208 Pseudoxanthomonas spa...
WP_003296475  159 P-SATVAASGGPESDD---AALFGILWP---LEESVKLDSTI---DRRTLRLQIARLNQLGYAFDATAQQWNL 221 Proteobacteria
Q5P5B7        140 AAPSPES----SADAD---EALFGALWP---LGDSVKLDATV---DRRVLRQQRDRLGALGYEFAPLSQDWHR 199 Aromatoleum aromaticu...
jgi:Tgr7_2832 139 --PAKPASKPVTQDDD---ATLFGALWP---LGEIVKLDATV---DRRLLRQQRDRLGALGYEFAPLSQDWHi 200 Thioalkalivibrio sulf...
CAP41650      138 --PETTSPSNASAEED---AALFGMLWP---LSEIVKLDATV---DRRVLRQQRDRLGAMGYRFEPLSQDWHL 199 Bordetella petrii
WP_011062940  141 --PAPPS----TNDID---AELFGTVWP---LSETVRLDTTV---DRQRLRAQCTRLEQLGFTMDFKTQTWSR 198 Pseudomonas protegens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap