Conserved Protein Domain Family
DUF3273

?
pfam11677: DUF3273 
Protein of unknown function (DUF3273)
Some members in this family of proteins are annotated as multi-transmembrane proteins however this cannot be confirmed. Currently this family has no known function.
Statistics
?
PSSM-Id: 403013
View PSSM: pfam11677
Aligned: 11 rows
Threshold Bit Score: 282.316
Threshold Setting Gi: 209556308
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7RFE7        10 GEAPEGRGPQfEPFWDFFmNFNLRVGFLIQFISYTLL-VCSITLIGKnpLGILNFLRALPGTVGNAPMpLVFLSIGGFLL 88  Plasmodium yoel...
EEA06353      12 TGITTKQGPS-IPIESLF-YAFLRLGIFFEIMCFTGLtLISYVSTGS--LMLNYHSFPENMLQGSIPS-YVSLCFFLGLI 86  Cryptosporidium...
Q8IM26        12 DNCHTNRGPC-FQISGFF-GTTLRIGFFLEFIALTFLfMSYWSNGGKglFSYDLKNINDEYRLDQTFRnSITLWTGVYLI 89  Plasmodium falc...
Q4N1E6        12 DGAPPNRAPC-VSFGGFF-NSSLRMGFGLQFLALLSLnFVYYSFNGKgvFSYDLSGLPEETRLDPSFRfYTTTASMVYML 89  Theileria parva
XP_001612020  13 DGIPPSRAPS-VTFNFLF-NNTLRMGFGMQLIGFVGMnLVYFAYGGKglFTYDIAGLPEASRLDEGFRgHITTFSMIYML 90  Babesia bovis T2Bo
XP_001611017  46 NEVISPRGEQhTPMVGFFsSKLLRSGLTFQCASLTLMfIFYWAFGGNgiFVFDLYAAPESVKISRPFHlTVSSLQAIYLL 125 Babesia bovis T2Bo
Q7RAP4        29 EESPSPRGEShTPFIGYFsSHLLRTGFLLQCLSLILMfVFYWAFGGTgiFIFDLYAGPECVKVSSAFHlTISVLMSIYLL 108 Plasmodium yoel...
XP_002140625  11 GDAPEGRGPShPLFFEKFlANNLKLGFGLILLGFIGTlLCSISAG----YGLQVIKFLSPFNDATIPTsVSFVFIMILII 86  Cryptosporidium...
XP_627579     10 GDAPEGRGPSqPLFFENFlVNNLKLGFGSMLLGFIGLtICSIFSG----FGLHITKFLSPFNEATNSTgTALFFMIFMIF 85  Cryptosporidium...
XP_001611289  10 GEAPESRGPQfEPVWEFLmNYNLRAGFALQLLSFVIL-AIGIYNGGKdpFAILTFFRALPENFGVTPFsLTLICHGGFIV 88  Babesia bovis T2Bo
Q4UB95        10 GEAPESRGPQfEPFWDFLmNYNLRFGFLVQFAAFLLL-FLGVLTGGKdpLALLSFLKADPKNFGSAPFsMTLLCHALFLA 88  Theileria annulata
Q7RFE7        89 GTLLIMSFLQLTEDDSSIkqSRGYRAGTKFLLQATSMGTVSWSLSLICLMAS--SYYFDDPWMEEKIGAGSSWILYFSSR 166 Plasmodium yoel...
EEA06353      87 GAGKLMVFQILLADDTCF--ARGYVTGSKIIKVASLLDLVGKMICFVFTLQLggTSENAIEFNTAVAQGGVEINFLTFGQ 164 Cryptosporidium...
Q8IM26        90 GAIFIMSFQVLLADDTCW--ARGYRAGSKILRLASFLDTISATLQFIFYLYI--SKFYTRKWYVHFNEGGSEWVFFIFVR 165 Plasmodium falc...
Q4N1E6        90 GSLSLVCFQVLLADDTCW--ARGYRSGSKILRLATFLDTVSSTLQFIFYLYV--SKFYSKRWYAHLNEGGSELVFMVFTR 165 Theileria parva
XP_001612020  91 GSLSLMCFQVLLADDTCW--ARGYRSGSKILRLATFLDAISSTMQFIFYLYI--SKFYTERWFVHLNEGSSELVFFVFTR 166 Babesia bovis T2Bo
XP_001611017 126 GTFYVAMFQVFVSDNSKA--VRGFRAGSKILSAAVTLDLISSMLRLVQYIYA--YFYMSMKWWTRYQQTKADWIFFQFGS 201 Babesia bovis T2Bo
Q7RAP4       109 GTLYIAMFQVFVADNSKW--CRGFRAGSKLLSAAVTLDLLSSILRLVQYLYA--YFYMNMRWWARYQQTKSDWTLLHFGS 184 Plasmodium yoel...
XP_002140625  87 GVLCLNVSTVLMDDDGSIsqTRGYRAGCKALGQGTLVTLLGLILLIVTIYSN--ISYYEGNALKGINLNSIIECLFYSGI 164 Cryptosporidium...
XP_627579     86 GVICLNMSTILMDDDGSIsqTRGFRSGCKAFGQGSLVILLGLILIVVTLYSN--VGYYEGNALSGLDLNHVIKCMYNAGL 163 Cryptosporidium...
XP_001611289  89 GTLLIMSFIQMSEDDSSIkqCRGYRAGTKFMLQATSFGAVSWCLSMVTFLGA--TYHFGAQWMEEQIGDGSNWLIYFSSR 166 Babesia bovis T2Bo
Q4UB95        89 GTLLIMSFIQMGEDDGSIkqCRGYRAGTKFLLQATSFGAVSWCLSMITFLGA--SYHFDSQWLDEQIGDGSSWLIYFSSR 166 Theileria annulata
Q7RFE7       167 LIDAFCLFLYGSGCFFLEVYHSEGAGEAWGWLCGMCFIATSFVEVLALTLynspiFESLDWfyCVFLGVSLVASSIWGIL 246 Plasmodium yoel...
EEA06353     165 VLSGIAFISYGFGFLLLELFQDEGVGNVYGYINFFSFVSAGIAILIYAIS-----FKTSGA--NFVALVALMGAFIWASF 237 Cryptosporidium...
Q8IM26       166 LVHAFSCLLYGLAAYLLEVYHDEGAGDLHAYINGVMFVFAGLTEIFVI-------FCNSGCysNLLLWLALGAVSLWSYY 238 Plasmodium falc...
Q4N1E6       166 NIHACACLLYGVACYLLEVYHDEGAGDLHAYLNGVLFVATGVMEFAVL-------LFNVNGayTPLLLLSLAAATLWAFY 238 Theileria parva
XP_001612020 167 ISHAFACFLYGLACYLLEVYHDEGAGDLHAYLNGVCFVLTGCAELMVL-------IFQKGMlaTPLLLITLAAATLWAVY 239 Babesia bovis T2Bo
XP_001611017 202 FTNSFALVMYGAAFFYLEAYHDEGTSEEVAWTNLVLFCLAGLTELLMV-------FTGYGAlfSLFLLAAIMSATVWSFS 274 Babesia bovis T2Bo
Q7RAP4       185 IVHSFSLFIYGAAFFYMEAYHDEGTYEELAWSNLTLFKLAGLAELLMV-------FSGFGAffSILLLGAIMCATVWAFS 257 Plasmodium yoel...
XP_002140625 165 GLTSIGITLLGLAVFLIEVYSNDGTREMMGFASLGLCKLSGLLMIAALIFp---sFKFLDTlfSIVVVLTFSHITAWASV 241 Cryptosporidium...
XP_627579    164 AITSVGLTILGFAAFLVEVYSSDGTREILGFASILLCKVSGIFMFLTIIFp---dCKTIGSlaTLVTIIALTHVTLWAGI 240 Cryptosporidium...
XP_001611289 167 LFDAFALFLYAGGCFFLETYHSEGTSESWGWLCGLAFFAAAVFEVLALNCinsgmFAILERlyTFAMVIGLLLSTIWAFI 246 Babesia bovis T2Bo
Q4UB95       167 LLDSFALVLYAGGCFFLETYHSEGTNESWGWLCGSTFLTAGVLEIASLNFlntpaFVVLERlyTVAFGLSLFLSSMWALL 246 Theileria annulata
Q7RFE7       247 FEPISHRYDVKLTQSAMRNEY-----YKSRNAMAY 276 Plasmodium yoelii yoelii
EEA06353     238 FEPAVNEFSPSLGETELTNDVet-qvEKFTRTSHY 271 Cryptosporidium muris RN66
Q8IM26       239 FEPEVNHVSPALHETELTNDVeq-qvEKFSRYTPY 272 Plasmodium falciparum 3D7
Q4N1E6       239 FEPEVTFVSPTLEETELTNDVeq-qvEKFTRLtpt 272 Theileria parva
XP_001612020 240 FEPEVTFVSPALQETELTNDVeh-qvEKFTRLtps 273 Babesia bovis T2Bo
XP_001611017 275 FEPLLEKWSPSLHSRDVNADFaedayEQGYQQASY 309 Babesia bovis T2Bo
Q7RAP4       258 FEPLLEKWSPELHSRDINADVlp-eiKHDDENCGY 291 Plasmodium yoelii yoelii
XP_002140625 242 FETIAMKSNIKMTQSAVRNEY-----YKSRNALAY 271 Cryptosporidium muris RN66
XP_627579    241 FESIALKSRIKMTQSAVRNEY-----YKSRNALAY 270 Cryptosporidium parvum Iowa II
XP_001611289 247 FEPVCHRYDVKLTQSALRNEY-----YKSRNAMAF 276 Babesia bovis T2Bo
Q4UB95       247 FEPVSHRYDVKLTQSALRNEY-----YKSRNAMAY 276 Theileria annulata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap