Conserved Protein Domain Family
DUF3268

?
pfam11672: DUF3268 
zinc-finger-containing domain
This is a family of bacterial and plasmid sequences that carry at least one zinc-finger towards the N-terminus and a possible second at the C-terminus.
Statistics
?
PSSM-Id: 403009
View PSSM: pfam11672
Aligned: 11 rows
Threshold Bit Score: 170.598
Threshold Setting Gi: 237876846
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CCX93948       13 TAPRCPYCGSHTILRSADGIYRENA--RNDMLY--VCknyPVCDSYVRVQRGTKI-PLGTVANRELRELRAEAHRQFDKL 87  Firmicutes bac...
CDD27375        7 KPMRCPYCGAPVVYRSADGIYQNNK--NGAMLY--VCsryPECDAYVRVQPGTTI-PLGTLANGDLRALRRETHHYFDKL 81  Firmicutes bac...
CDC72916       15 SSMRCPYCGSAVVYRSADGIYHENK--KGTMLY--VCsnfPECDAYVRVHAGTNI-PVGSLANHELRSLRRTAHHYFDQL 89  Firmicutes bac...
jgi:Cpin_3857  10 SGQKCPYCGRKTVYVDSAEIY-ALS--YG-MIY--LC---RPCNAYCGVHKGTDI-ALGRVANATLRNLKKEAHSHFDQL 79  Chitinophaga p...
WP_013006610    5 LTPLCPYCGGWSARVTGRDLYPHRSdlFERLFY--RC---EPCDAHVGCHPGTGK-PLGRLANAALRRAKSQAHAAFDRI 78  unclassified T...
CBK97808        4 RIVICDYCGTPADFVDSSVVYHGHS--FG-MIY--LC---PRCGAYVGVHKGSDK-PLGRLANSELRNWKKAAHAAFDPL 74  Faecalibacteri...
CDB88226        1 MTVYCDYCGHKAALVDDSEIY-GRS--FGHTAY--LC---RNCGAYVGCHGRTDK-PLGRLADATLRKWKMAAHASFDPL 71  Firmicutes bac...
YP_001504314    6 VPDNCTYCGEKVIWTSNEVLY-GRTygNGKCYY---C---TGCGASVGTHKNRPKePLGILATPPMKRWKKLCHDLFDPI 78  Enterococcus p...
ACR29179       34 APTVCRFCGGSVHIVRNSEIY-GRE--YGEWPWafLC---RKCGAYVGMHPQTGI-PLGTLADGPTRAARKRAKAAFQPL 106 Burkholderia g...
jgi:Chro_5779   7 STTCCPYCGSPITLANAEKIY-GRK--GFGRVW--MCtryPDCDAYVGAHQNGS--PKGSLANRQLREWRQAAHAAFDPL 79  Chroococcidiop...
WP_005333505    5 KIIRCPYCGGTAILRDASFVYGTHS--HGGQVY--VCshyPSCNSYVGVHPGTKI-PKGTLANRELRQKRIQAHRIFDQI 79  Clostridiales
CCX93948       88 YKHGYM--SKHDAYQWLGGILSVPAKQAHIAQLSLLSCNLVIREAKKQ 133 Firmicutes bacterium CAG:110
CDD27375       82 YTSGRM--TKQEAYRWLANFLQAPQSQAHIGYLGEYTCRQVLCACKEM 127 Firmicutes bacterium CAG:94
CDC72916       90 HESGFM--SKQDAYQWLADLICAPLSEAHIGHLGEYYCKQVIEESRKI 135 Firmicutes bacterium CAG:272
jgi:Cpin_3857  80 WKQKGM--TRKNAYKWLSSSMDIPKDLTHIGMFDEEQCRKVINLCKTK 125 Chitinophaga pinensis DSM 2588
WP_013006610   79 WQNGAM--SRSQAYAWLARQMALPKSECHIGDFDEGQCAAVVELCRRH 124 unclassified Thioalkalivibrio
CBK97808       75 WKYGPYrgRRNEAYRWLSEKMDTPIEFTHIGMFDVDQCRKVIRIMREE 122 Faecalibacterium prausnitzii L2-6
CDB88226       72 WKTGPFrgRRKAAYGWLAGQMGLPVEKTHIGMFDVPQCQEVIKIIEKG 119 Firmicutes bacterium CAG:170
YP_001504314   79 WQSKQI--SRGELYSVLAYKLGIPKEDCHFGHFNEEQLKRAWQVIKEP 124 Enterococcus phage EF24C
ACR29179      107 WQTRVM--TRSAAYSWLAGRLGIAVGECHVGWFDVAMCDRVVEIINEG 152 Burkholderia glumae BGR1
jgi:Chro_5779  80 WQSGKI--TRNAAYKWLSQQLAIPKSQTHIAMFDIDRCQAVVKLMQRY 125 Chroococcidiopsis thermalis PCC 7203
WP_005333505   80 WQQGIL--SKPEAYRWVADKFCLTDKQAHIGQFSNYMCDQLIRESADV 125 Clostridiales
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap