Conserved Protein Domain Family
MSP1a

?
pfam11670: MSP1a 
Major surface protein 1a (MSP1a)
MSP1a is part of the A.marginale major surface protein 1 (MSP1) complex and exists as a heterodimer with MSP1b. The complex has adhesive functions in bovine erythrocytes invasion.
Statistics
?
PSSM-Id: 371661
View PSSM: pfam11670
Aligned: 3 rows
Threshold Bit Score: 272.286
Threshold Setting Gi: 501859304
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012658934     58 MGTVIGAKRKIRERSMVSFFG------------AGQFIITIAALVAAIFAIC-ACLRTTLAGPSgtLIWGCLALVVLLPL 124 Anaplasma ma...
wsu_vmp:AMF_396  31 RATVAKACKEMRDRSMSSFAG------------AGQFIITMSALIAAVIAICgACLQPAVAGSA--LSWSCLAFVLLLLL 96  Anaplasma ma...
WP_012658931    508 HGKVVDAVDRAKEAAKQAYAGvrkryvakpsdtTTQLVVAITALLITAFAIC-ACLEPRLIGASgpLIWGCLALVALLPL 586 Anaplasma ma...
WP_012658934    125 LGTVAYMAVQDEREDGVVADYARVVRegSVWEHQRQLLEDRSTFSGMRALAAMAVFEFICAIVACACMAAKPGTWQGSAL 204 Anaplasma ma...
wsu_vmp:AMF_396  97 VVATGVIVAANNIADIATGSDVRIVK--PSRKGCRELSDDGGRSKAMVALACISALALIGVIVACICIDVNRGGWCGGFM 174 Anaplasma ma...
WP_012658931    587 LGMAVHTAVSASSQKKAAGGAQRVAAqeRSRELSRARQEDQQKLHVPAILTGLSVLVFIAAVVACIAVDARRGTWQGSIC 666 Anaplasma ma...
WP_012658934    205 fLATLALFMASA-------------VVVVGTRRHS----------SVLVLSDAPVVGLSPdvrpaaPSGGQQ-----APV 256 Anaplasma ma...
wsu_vmp:AMF_396 175 -LAALVLFTIAAffgtelsrghtgyTVVEYGPDEA----------YHITVNAVPASDGQE------ASRGSNedsgqVKT 237 Anaplasma ma...
WP_012658931    667 fLAAFVLFAISA-------------AVVMATRDQSlaeecdskcaTARTAQAVPGGQQQPrategvVSGGGQeggagVPG 733 Anaplasma ma...
WP_012658934    257 TAVPadacrssadaPGTSVSSV---VLDSTAASGAGVSgqqaaLHLARENGASVGICA 311 Anaplasma marginale
wsu_vmp:AMF_396 238 ADVP----------PDTFVVTVgldSPDSLATLGNFVV-----LGFSPQLQCRVYTEA 280 Anaplasma marginale str. Florida
WP_012658931    734 TSVPsaes--gavpPATIMVSV---DPQLVATLGAGVA----------------QAAA 770 Anaplasma marginale
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap