Conserved Protein Domain Family
Toxin_YhaV

?
pfam11663: Toxin_YhaV 
Toxin with endonuclease activity, of toxin-antitoxin system
YhaV causes reversible bacteriostasis and is part of a toxin-antitoxin system in Escherichia coli along with PrlF. The toxicity of YhaV is counteracted by PrlF by the formation of a tight complex which binds to the promoter of the prlF-yhaV operon. In vitro, YhaV also has endonuclease activity.
Statistics
?
PSSM-Id: 403004
View PSSM: pfam11663
Aligned: 31 rows
Threshold Bit Score: 183.987
Threshold Setting Gi: 501117955
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q89TU0            13 VYAHPLFLDQFETMIAAVEKARKKDP-KGYKKKRAAKLLSAVLKVAFDDIPSDPTRDVYRQGGTLGD-EYKHWFRAKLLQ 90  Bradyrhizob...
CAX60388          11 FYFHSCFLTQLAELQNKVLALKKKDP-QGYHKKKETKLLAAIEQIITRVIPANPLDSHFRQGNTLGQ-DYRHWYRVKFLQ 88  Erwinia bil...
P64594            12 LYAHPCFQETYDALVAEVETLKGKDP-ENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSgKNKDWSRVKFGA 90  Escherichia...
WP_015220445      11 IYFHPLFYQQWLELVNRVKYLKQRSApENFVTHPDVKLLKALDQGIKDKIPKDPFASYFALKKPLQ--KYSRLKKMGLPS 88  Cyanobacter...
WP_015192019      11 IFFHPLFNAPWISLVAKVKQLKTKLEpKDFVTHPDTKLLKAIDLGIKDKIPSNPFASYFALQKPLH--KYGRLKKMGLPN 88  Stanieria c...
WP_015079922      15 IFFDPLFNTQWIELRDKVKKLKDELPkEEFIKHPDAKLLKALNIGIKEKITQDPFASYFILQKPLQ--KYGRLKKMGLPE 92  Anabaena sp...
WP_012167212       9 yfLKRLFGQQRLALRTEVKRLKATLPpEDYVRHPQVKLYAATMQAIKAKIPADPFASHFALTGPLK--KFGRVKKMGIPN 86  Acaryochlor...
WP_015197878      12 YFHPQLFGTQYQELFDRVSELRKKLPeSEFKTHATVKLFAAITIAIETKIPSDPLASHFALTGALK--RYGRVKKMGLPE 89  Calothrix p...
jgi:Nos7107_0412  12 YFHPQLFGSQYQELFERVSQLQQQLPePEYKTHTTVKLFAAINLVIETKIPNDPFASYFALTGALK--RYGRVKKIGLPE 89  Nostoc sp. ...
WP_015158542      12 YFHRQLFGEQRRQLRERVKQLKAELPeADYLTHPDVKLLAAVMVGIKEKIVLDPLATQFALTGPLR--RYGRMKGMGLPQ 89  Chamaesipho...
Q89TU0            91 -QFRLFFRYQqsADAKIIVLAWVNDDSTLRAYESANDAYAVFRKMLDRGNPPDSWNELVAAAS 152 Bradyrhizobium japonicum
CAX60388          89 -QFRLFFRFS--VPHRTIIIGWVNDFGMLRAYGSKTDAYRVFERMLKSGEPPDDWDALLKHCQ 148 Erwinia billingiae Eb661
P64594            91 gRYRLFFRYS--EKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETE 151 Escherichia coli K-12
WP_015220445      89 -RYRLFFRVFk--EANTIIILWLG---FPRKERDKKDCYKVFSKMVINGNFPEDIASFLDLAN 145 Cyanobacterium aponinum
WP_015192019      89 -HYRLFFRAF--KEKKVIIILWLG---FPRKEGDQKDCYQVFSKKILKGEFPNSLDDFLREYQ 145 Stanieria cyanosphaera
WP_015079922      93 -RYRLFFRVF--KEQKIIIILWLG---FPRKEGDKKDCYQVFTKKVENGDFPENVDQFMIeym 149 Anabaena sp. 90
WP_012167212      87 -RYRLFFRAFkvPESQSIFVLWLG---YPRKEGDKKDCYRAFRKMVERGDFPDSLDDLMVESE 145 Acaryochloris marina
WP_015197878      90 -RYRLFFRAFdtPKLKSIVILWLG---FPRKEGAKDDCYQVFTKMVARGTFPDSLDELIKEpg 148 Calothrix parietina
jgi:Nos7107_0412  90 -RYRLFFRAFdtEQLKAIVILWLG---FPRKAGAKDDCYQVFTEMIEQGKFPDSLDELITEd- 147 Nostoc sp. PCC 7107
WP_015158542      90 -RYRLFFRAFtsEERQVLIVLWLG---YPRKAGDKQDCYEVFTKMVGNGDFPDNLPELLMATd 148 Chamaesiphon minutus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap