Conserved Protein Domain Family
DUF3811

?
pfam11656: DUF3811 
YjbD family (DUF3811)
This is a family of proteobacteria proteins of unknown function. This family is unrelated to pfam03960 which contains a set of transcription factors that are also named YjbD.
Statistics
?
PSSM-Id: 402999
View PSSM: pfam11656
Aligned: 10 rows
Threshold Bit Score: 63.3001
Threshold Setting Gi: 117560332
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
tigr:AHA_3961   2 KDLTDAEKAEITLLLQKAQANTDHQLSNAERNRIREEGRLKIVADRAAAAKVAAKlarEKAKERANKQvLPETFSWVDSV 81  Aeromonas hydr...
utah:Sant_1989  9 KEMTDSEQRELKTLLDRTRKAHGRPLTNGESNRIKDEFIARLTAEREAAAKQARA---AKKKLALKPD-ISATYQWSAQM 84  Sodalis praeca...
WP_002445414    9 KEMTDAEQRELKTLLDRERIAHGRTLTNSEANRVKKEYIDKLMIQREADARKARQ---AKKKQAYKPD-ASSTFSWSAST 84  Shimwellia bla...
Q328Q0          9 KEMTEREQRELKTLLDRARIAHGRVLTNSETNSIKKEYIDKLMVEREAEAKKARQ---LKKKQAYKPD-PEASFSWSANT 84  Shigella dysen...
WP_004242966    7 QEMTDAQQMRVRTRIGQERKKLGRELTNAEMNKVKDAIITEISLEVEKASKKALS---QKKKQKLVS--SDETYSWSAQN 81  Proteus
WP_004235101    7 AEMTEPQKIRVRTRLAQEQKKLGRPLTNAEQNKVKDQIITEISKEVDAAAAKVRA---QKKKDKIKPGgGEETFNWSAKT 83  Morganella
WP_002210964    7 KEMTESEQRDVKTQLDRARINLGRALTNSEQNKVKDEAIEKIMHAREQIAKLTRV---ERKTKKTAP--STTTFSWSASI 81  Yersinia pseud...
WP_024913081    7 KDMTESEQREVKTELDRARKHHGRPLTNAEQNRVKDEAIERIMAAREKIAKVARA---ERKAKRAQP--TSATFSWTASI 81  Chania multitu...
KFD10658        7 QDMTESEQRELKTLLDKARKAQGRELTNSENNRIKDDYIDTLMAEKEKVAAKARA---EKRRNKAVPS-TSATYDWTART 82  Rahnella aquat...
Q6D513          7 KDMTESEQRQLKTLLDQARKKQDRPLTNSESNHIKDDYIDKLMKEREAVAKQARA---EKKKNKFKPD-SSTTYEWSANT 82  Pectobacterium...
tigr:AHA_3961  82 SNkfRSKR 89  Aeromonas hydrophila subsp. hydrophila ATCC 7966
utah:Sant_1989 85 HS--RGKR 90  Sodalis praecaptivus
WP_002445414   85 STanRGRR 92  Shimwellia blattae
Q328Q0         85 ST--RGRR 90  Shigella dysenteriae Sd197
WP_004242966   82 HR--RGYR 87  Proteus
WP_004235101   84 HT--RGLR 89  Morganella
WP_002210964   82 ST--RPPR 87  Yersinia pseudotuberculosis complex
WP_024913081   82 ST--RPHR 87  Chania multitudinisentens
KFD10658       83 HP--RGRR 88  Rahnella aquatilis CIP 78.65 = ATCC 33071
Q6D513         83 NL--RGRR 88  Pectobacterium atrosepticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap