5UU5


Conserved Protein Domain Family
P22_CoatProtein

?
pfam11651: P22_CoatProtein 
Click on image for an interactive view with Cn3D
P22 coat protein - gene protein 5
This family of proteins represents gene product 5 from bacteriophage P22. This protein is involved in the formation of the pro-capsid shells in the bacteriophage. In total, there are 415 molecules of the coat protein which are arranged in an icosahedral shell.
Statistics
?
PSSM-Id: 402996
View PSSM: pfam11651
Aligned: 8 rows
Threshold Bit Score: 397.626
Threshold Setting Gi: 409023364
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5UU5_B                  1 MALNEGQi--VTLAVDEIIETISAITPMAQKAKK-YTPPA----ASMQ-RSSNTIWMPVEQESPTQEGWdl-tdKATGLL 71  Salmon...
WP_012436112            1 MANTILT---IDMITREALRLFKNSNAFLKSIDRqYDEDFa--kSGAKiGSALRVRLPNDFTVRRGAAA-----SVQGTN 70  Ralsto...
WP_015874057            1 MANNLESn-iSQIVLKKFLPGFMSDIVLCKTVDRqLLSGE----INSNtGDSVSFKRPHQFKSERTETGditgkDKNGLF 75  Candid...
goetting:EBL_c21750     1 MATNNLDsnvSQIVLKKFLPGFMSDLVLAKTVDRqLLAGE----INSStGDSVSFKRPHQFASKRTETGdisgqAKNNLI 76  Shimwe...
Q2G3Y7                  1 MATSFTKq--EQVMFDNVIEGFDDMLVIGKAAEV-YQPLD----AQEQvNAQDKFWLPAPMIGASYDGFdq-saNFDGLT 72  Novosp...
WP_004904183            1 MALNEGQi--ITYMVDEVVNTIENNCPMAQRVSK-YTPPA----ADLQ-RSQNTIWMPVEQEAPTQPGWdl-tnKATGIV 71  Morgan...
jgi:Swit_4452           1 MANSLLT---IDVIAKEALSVLENELVAAKAVHRgLESEFgnakNGYSsGATVTIKRPTDFTVRSGANA-----SVQDVI 72  Sphing...
EdlabUofT:DCF50_p1388   1 MGNTILT---PSIIAKEALLQLRNNTVMANLVHRdYSQEF-----VAGvGNTVTIRKPATFEAQEFNRStg--iQIQDAT 70  Dehalo...
5UU5_B                 72 ELNVAVNMGEPDNDFFQLRADD--LRDETAYRRRIQSAARKLANNVELKVAN-------------MAAEMGSLVITSPDA 136 Salmon...
WP_012436112           71 EQKTSLVMANQIGVDIQFSSAEraLSLDDYSERILKPAINDIAGQIAADIMGgmdglvpagtlypDTQLPASNLVGKFDG 150 Ralsto...
WP_015874057           76 SAKATGKVGKYITVAVEWTQIEeaLKLNQL-DQILSPIHERMVTDLETELAH-------------FMMNNGALSLG---- 137 Candid...
goetting:EBL_c21750    77 SGKATGRVGNYITVAVEYGQLEeaIKLNQL-DEILQPVRERIVTDLETELAQ-------------FMMSNGALSLG---- 138 Shimwe...
Q2G3Y7                 73 QLNVPASVGYHKSVPKTLSSKN--LRNAFAMGQYGKAAKQKLSSDVNLALFN-------------TVALYGSVFSKRTGA 137 Novosp...
WP_004904183           72 ELSVKCNMGVPDNDFFTLRADD--TRDETSIRRRMKASGLKLANNIETSIAK-------------QAADTASLIVTDVDH 136 Morgan...
jgi:Swit_4452          73 EGSTTITVDQQKGVDFAFTSAEltLSIKDLSERVIKPAMVQLANKIDSDVL--------------SLAAKVPNWVG---- 134 Sphing...
EdlabUofT:DCF50_p1388  71 EGSESVVLDKLLDVSFEVTAEQltMDIRDFSEQLLIPAMQGFANKIDLYLL--------------GLYNDIPFNFGTAGS 136 Dehalo...
5UU5_B                137 IGTNTADAWNFVADAEEIMFSRELNRdmGTSYFFNPQDYKKAGYDLTKRDIFG-RIPEEAYRDGTIqRQVAGFDDVLRSP 215 Salmon...
WP_012436112          151 SNNLLNADLNTFLSANARLNKLSAPG--NRKIVLDPITEARMVGSLAGLLNPS-NEISEQFLTGQM-KRGLGFTWMMDQT 226 Ralsto...
WP_015874057          138 SPNTAIKKWADVAQTASFIKDIGIKTg-ENYAIMDPWSAQRLADAQSGLHAAD-QLVRTAWENAQIsGNFGGIRALMSNG 215 Candid...
goetting:EBL_c21750   139 SPNTPINKWSDVAQTGSFMKDLGIKTg-ENYAVMDPWSAQRLADAQSGLHGSD-QLIRSAWEDAQIsGNFGGIRALMSNG 216 Shimwe...
Q2G3Y7                138 ATG-----YDDVADIDSRLTRIGVPTd-GRMAFYSPTNMNAMAGNLAGRSEAT-ERSRTAFERAMIrSDVAGIEVFKNDQ 210 Novosp...
WP_004904183          137 VAVE-NKAWDMMSDAEALIFQRELNRsqGLSYFFNADDYKKAGMSLAGKDMYG-RIPEEAYKSGTIqKQVAGFNDVLRSP 214 Morgan...
jgi:Swit_4452         135 TPGQIVNSFQDFAPAPQRLDEQGVMSd-GRTAILSPADQWGMLGSQTNLYIQG--AASDAYRKGDL-GTIGGIDTRMSQN 210 Sphing...
EdlabUofT:DCF50_p1388 137 TPS----EISDVTGARKVLNDNKVPFa-NRNLVIDTAAEDKFLQLATFHEADKvGDNGTALREASL-GRKFGFNIFMDQN 210 Dehalo...
5UU5_B                216 KLPVLTKSTA---TGITVSGAQSFKPVAwqldndgnkvnvdnRFATVTLSATTG-----MKRGDKISFAGV-KFLGQMAK 286 Salmon...
WP_012436112          227 VLAHTTGAYG---TPPTVSGANQSGSGL--------------GTMTLNVSALNGp----VNAGDVFTIAGV-FAVNRVTK 284 Ralsto...
WP_015874057          216 LASREQGDFG---GTLTVKTAPNVDYLSvk----------dsYQFTVALTGATPsktgfLKAGDQLKFTST-HWLNQQSK 281 Candid...
goetting:EBL_c21750   217 LASRTQGAFG---GTLTVQTAPTVTYNAvk----------dtYQFTVTLTGATAsvtgfLKAGDQIKFTNT-YWLQQQSK 282 Shimwe...
Q2G3Y7                211 EIRLAAAG-G---GATTVNGANQRTVPAatvtsagvtenkdnRYTDLVITATTYa---nVKIGDAFTIAGV-NEIHLITK 282 Novosp...
WP_004904183          215 KLPTLTAGTA---TGVTVDGAQKFKPEAwkedvdgnrenvdnRTAVVKVSDGSa-----FKRGDKISFAGV-KFISQMAK 285 Morgan...
jgi:Swit_4452         211 VQSITTGSRA---GSILIDLSITGSTIDyatv-------kdtMIQTIHMDSFTNat-dtVKAGEVFTIAGV-YAVNPVTK 278 Sphing...
EdlabUofT:DCF50_p1388 211 VKKHTKGTLAgdaGTIKVKGAVSAGS------------------TQLVIDGTNMtg--tLLKGDLLSIDGKpYAIIENTt 270 Dehalo...
5UU5_B                287 NVL---AQDATFSVV--R-----VVDGTHVEITPKPVALDDVSLSPeqraYANVNTSLADAMAVNILNVKDART--NVFW 354 Salmon...
WP_012436112          285 QAY---PELQQFTVV--Qa---aAAGATSLSIYPSINPPVGGNPVQ----YQTVTASPANGAQITFLTNASAQYrmNLAY 352 Ralsto...
WP_015874057          282 QTLyngSTAMIFTAT--VleetnSTASGDVTVKLSGVPIYDEKNSQ----YNAVDAKVKAGDAVSIIGTAKQQMkpNLFY 355 Candid...
goetting:EBL_c21750   283 QVLyngSAPISFTATvlSda--nSTAGGAVTVTLSGVPIYDTTNSQ----YNAVSHQVDAGDEVTVIGTAGQTMkpNLFY 356 Shimwe...
Q2G3Y7                283 QDT---GNLKTFRVV--D-----KPAANTIRIWPAIIDAAEGSIGSk--eYANVSATPANGANITWLNTTAAPL--NPFF 348 Novosp...
WP_004904183          286 DLL---TQDATFAVV--------GVDGNNITIMPKPIALDDAALKPeeraYANVNTSLAAGAAISVINVKTAKT--NIFW 352 Morgan...
jgi:Swit_4452         279 ARL---PWLKQFTVV--Ada-tcASNETDVVIYPAMIWTGAFQNVS------VVGVTDLNNQAVTFLGSAATTYaqNLVF 346 Sphing...
EdlabUofT:DCF50_p1388 271 ----------------------aVTNEIAVKLYPA-------------------TADIADDTEVTIVSTHTA----NLAF 305 Dehalo...
5UU5_B                355 ADDAIRIVSQPIPANhELF-AGMKTTSFsipdVGLNGIFATQGDISTLSGLCRIALWYGVNATRPEAiGVGLPG 427 Salmonella v...
WP_012436112          353 VPEAITMVTADLELP-KGV-HEAYRETY----DNTSMRIVTAYNVQTDQFITRLDILYGFKALRPEW-IVRVAD 419 Ralstonia pi...
WP_015874057          356 NKFFCGLGTIPL--PkLHS-IDSAVATY----EGFSIRVHKYADGDANKQMMRFDLLPAYVCFNPHM-GGQFFG 421 Candidatus H...
goetting:EBL_c21750   357 NKFFCGLGTIPL--PkLNS-IDSAVATY----EGFSIRVHKYSDGDANVQKMRFDLLPAYVCFNPHM-GGQFFG 422 Shimwellia b...
Q2G3Y7                349 RKESLLLIPGSFTVNpDDG-WQVMTATTd---LGISITYTRQGAINDLSVKARWDIDFGTALLSPEMaGVQMFG 418 Novosphingob...
WP_004904183          353 ADDSITLLSQPIPLNhALF-SGMKTEAFnipsVGLNGVVAYQGDISTLEGKCRIAVWYSACTKRPEAvGIGLTG 425 Morganella m...
jgi:Swit_4452         347 HKNAFALAIVPMVSP-PGA-KDVARQSY----SGTSVRLIPFYNGSNDVSTMRLDVLYGFKALDPRL-ATRISG 413 Sphingomonas...
EdlabUofT:DCF50_p1388 306 HKNAFALVSRPLALPrGLSsEQKAIVNY----DGLGLRVIYDYNSQYKKDVISIDMLCGVKTLSSEL-ACRLLG 374 Dehalobacter...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap