5GAI


Conserved Protein Domain Family
P22_Tail-4

?
pfam11650: P22_Tail-4 
Click on image for an interactive view with Cn3D
P22 tail accessory factor
This tail accessory factor of the P22 virus is also referred to as gene product 4 (Gp4). The proteins structure consists of 60% alpha helices. Gp4 is the first tail accessory factor to be added to newly DNA-filled capsids during P22-morphogenesis. In solution, the protein acts as a monomer and has low structural stability. The interaction of gp4 with the portal protein involves the binding of two non-equivalent sets of six gp4 proteins. Gp4 acts as a structural adaptor for gp10 and gp26, the other tail accessory factors.
Statistics
?
PSSM-Id: 402995
View PSSM: pfam11650
Aligned: 4 rows
Threshold Bit Score: 220.912
Threshold Setting Gi: 506354339
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5GAI_P         1 TKGDLVRAALRKLGVASDATLTDVEPQSMQDAVDDLEAMMAEWYQDGKGIitGYVFSDDENPPAEGDDHGLRSSAVSAVF 80  Salmonella viru...
WP_002443478   6 TKGDIVLFALRKPAIASNASLTDVEPQSVEDAIQDLENMMYEWQINPGDI--GYLFAADGEEPLPDDDSGLPRKYMQAVG 83  Shimwellia blattae
WP_015874058   6 TKGEIVLFALRKAGIASEATNIDVEPQSFEEGINDLEDLMAELQITFGDL--GYQFSAEEENPTADDASGLPRKYKQVMG 83  Candidatus Hami...
WP_004904185   5 TKGELVVAALRKIGVASDATLTDIEPQSLEDGVNDLEAMMFEWHEDGKGIitGYKFAPDDTPIDQGDDHGISKAAISAVI 84  Morganella morg...
5GAI_P        81 HNLACRIAPDYALEATAKIIATAKYGKELLYKQTAI--SRAKRApypsRMPTGSGNSFPNLNEWHYFP 146 Salmonella virus P22
WP_002443478  84 YQLMLRILSDYNLEPSSGVLINAQRSYDALLTDTLIvpSMRRRG----DFPVGQGNKYDLYTADRYYL 147 Shimwellia blattae
WP_015874058  84 YQLMLRMLSDYGIEPTPRQEASAAAAYDALLTDTLSvpSIARRG----DMPVGQGNNYTALGTASYYV 147 Candidatus Hamiltonella def...
WP_004904185  85 YNLALRIAPDYQIAPLDKVITTARYGKERLLRTVSLrkAREARShypnGFPIGSGNRLATMNGYRYFH 152 Morganella morganii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap