2JMH


Conserved Protein Domain Family
Blo-t-5

?
pfam11642: Blo-t-5 
Click on image for an interactive view with Cn3D
Mite allergen Blo t 5
This family of proteins is Blo t 5, an allergen protein from Blomia tropicalis mites. This protein shoes strong reactivity with IgE in asthmatic and rhinitis patients. The structure of the protein contains three alpha helices which form a coiled-coil.
Statistics
?
PSSM-Id: 402989
View PSSM: pfam11642
Aligned: 6 rows
Threshold Bit Score: 154.913
Threshold Setting Gi: 160285626
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JMH_A     2 SQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKR 81  Blomia tropicalis
Q1M2M7   138 GEVSRTDKDELREEFDRLLVAVTMDHFHKLEQAMFNLSNQVIEFENTKSKTMKAEIIREISLALDFIAIAKGHIERELQR 217 Glycyphagus domesticus
Q1M2N1    54 VDVAIPNPDEFRNEFDRLLIHMTEEQFAKLEQALAHLSHQVTELEKSKSKELKAQILREISIGLDFIDSAKGHFERELKR 133 Lepidoglyphus destr...
Q1M2M6    16 AAPLAPNPDDFRNEYDRLLVITIQEKLADTEHFLARLSHQLVELNKSKSKAVKDQILLEIDFSLNFLAGANGHLERELKR 95  Glycyphagus domesticus
ABO84969  18 FIVDVDTEDKWRGAFDRMLMEEFEEKMDQIEHGLLMLSEQYKELEKTKSKELKEQILRELTIAENYLRGALKFMQQEAKR 97  American house dust...
Q2L7C5    20 FIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQYKELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKR 99  European house dust...
2JMH_A    82 TDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ 119 Blomia tropicalis
Q1M2M7   218 PDLNLLEKYNFEATLATGVVLTRDLTTLEKHVKSIEAQ 255 Glycyphagus domesticus
Q1M2N1   134 ADLNLAEKFNFESALSTGAVLHKDLTALATKVKAIETK 171 Lepidoglyphus destructor
Q1M2M6    96 TDLNFLEKFNFEELLATGTVLYKDLEETQKHVKAVETK 133 Glycyphagus domesticus
ABO84969  98 TDLNMFERYNFETAVSTIEILVKDLAELAKKVKAVKSD 135 American house dust mite
Q2L7C5   100 TDLNMFERYNYEFALESIKLLIKKLDELAKKVKAVNPD 137 European house dust mite
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap