Conserved Protein Domain Family
LcnG-beta

?
pfam11632: LcnG-beta 
Lactococcin G-beta
This family of proteins is LcnG-beta, which with LcnG-alpha constitute the two-peptide bacteriocin lactococcin G (LcnG). This family of proteins represents the N terminal domain which has an alpha-helical structure and is amphiphilic. Both peptides have a GxxxG motif which they use for interaction through a helix-helix structure.
Statistics
?
PSSM-Id: 402984
View PSSM: pfam11632
Aligned: 2 rows
Threshold Bit Score: 82.3694
Threshold Setting Gi: 930854903
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAS54009  1 MKNNNNNffKDMEIIEDQELVSITGGKKWGWLAWVEPAGEFLKGFGKGAIKEGNKDKWKNI 61  Lactococcus lactis
Q9L9U5    1 MKNIKNA--SNIKVIEDNELKAITGGGPGKWLPWLQPAYDFVTGLAKGIGKEGNKNKWKNV 59  Enterococcus faecalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap