2E12


Conserved Protein Domain Family
DUF3247

?
pfam11607: DUF3247 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3247)
This family of proteins is the protein product of the gene XC5848 from Xanthomonas campestris. The protein has no known function however its structure has been determined. The protein adopts a Lsm fold however differences with the fold were observed at the N-terminal and internal regions.
Statistics
?
PSSM-Id: 402965
View PSSM: pfam11607
Aligned: 2 rows
Threshold Bit Score: 165.191
Threshold Setting Gi: 503927826
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2E12_B         1 MPKYAPHVYTEQAQIATLEHWVKLLDGQERVRIELDDGSMIAGTVAVRPTIQTYRDEQEREGSNGQLRIDHLDASQEPQW 80  Xanthomonas cam...
WP_014161820   1 MSKYAERVHTDRNKIAELEALVTQLPSEARVALLLEDGRQLRGTVPVQPTVQIFRDAQEQEGVNALLRLDDLADPSHQHH 80  Pseudoxanthomon...
2E12_B        81 IWMDRIVAVHPM 92  Xanthomonas campestris pv. campestris
WP_014161820  81 LWLDQVRKVTPL 92  Pseudoxanthomonas spadix
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap