Conserved Protein Domain Family
CAF-1_p150

?
pfam11600: CAF-1_p150 
Chromatin assembly factor 1 complex p150 subunit, N-terminal
CAF-1_p150 is a polypeptide subunit of CAF-1, which functions in depositing newly synthesized and acetylated histones H3/H4 into chromatin during DNA replication and repair. CAF-1_p150 includes the HP1 interaction site, the PEST, KER and ED interacting sites. CAF-1_p150 interacts directly with newly synthesized and acetylated histones through the acidic KER and ED domains. The PEST domain is associated with proteins that undergo rapid proteolysis.
Statistics
?
PSSM-Id: 402959
View PSSM: pfam11600
Aligned: 4 rows
Threshold Bit Score: 74.3397
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
A0JMK9       247 RRSLKSVQEQEEKQRQRDEK-----------------------ERLKQEAKAAKEKKKEEARKMKEEKEREKKEKKEKDE 303  zebrafish
1_pfamImport   1 KVSQKTHQSAEEKEKLKLQKnildnkeglrksllniklafagqDQERAEKGRLKEEAKAAKERAREEARRKKEEEKELKE 80  
XP_005993835 312 KGSQNSSKSKGLKEKRRLEKeqeree------------krkklQAEKEEKERLREEVKAVKERAKEEAKKKKEEEKEQKE 379  coelacanth
A6QLA6       322 RITKKLVRGSAEKNKMKLQRdkerlr------------rqlklRAEKEEKEKLREEAK----RAKEEARKKREEEKELKE 385  cattle
A0JMK9       304 KERREKKERDEKEKADKLKAKEEQRQMKIE---AKLEEKRKKEEEKRLKEEK-DRIKAEKAEITRFLQKPKTQLAPKTLA 379  zebrafish
1_pfamImport  81 KERKEKKEKDEKEKAEKLRVKEEKRKEKQEaleAKLEEKRKKEEEKRLKEEEkRRIKAEKAGITRFFQKPKTQPVPKTLA 160 
XP_005993835 380 KERKEKKEKEEKEKAEKLRLKEEKRKEKQEaleAKLEEKRKKEEEKRLKEEE-KRIKAEKAEITRFLQKSKTPQVPKTLA 458  coelacanth
A6QLA6       386 KERREKREKDEKEKAEKQRLKEERRKERQEaleAKLEEKRKKEEEKRLREEE-KRIKAEKAEITRFFQKPKTPQAPKTLA 464  cattle
A0JMK9       380 SACGKFAPFEIKAHMSL 396  zebrafish
1_pfamImport 161 GWCGKFAPFEIKENMVL 177 
XP_005993835 459 GSCGKFAPFEIKENMVL 475  coelacanth
A6QLA6       465 GSCGKFAPFEIKEHMVL 481  cattle
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap