3C9A


Conserved Protein Domain Family
Argos

?
pfam11581: Argos 
Click on image for an interactive view with Cn3D
Antagonist of EGFR signalling, Argos
Argos is a natural secreted antagonist of EGFR signalling which functions by binding growth factor ligands that activate EGFR by forming a clamp like structure using three disulphide-bonded beta-sheet domains.
Statistics
?
PSSM-Id: 371613
View PSSM: pfam11581
Aligned: 7 rows
Threshold Bit Score: 220.074
Threshold Setting Gi: 1005940840
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3C9A_A        69 TIADKTRHYKMCQPVHKLPVCKHFRDYTWTLT-TAAElNVTEQIVHCRCPRNSVTYLTKREP--IGNDSPGYRYLFACSP 145
EFA11599     114 TLADKTRQYKLCEPVKKIPKCRFFRDTTWTIT-LYTN-NVTEQIVHCHCPKNSMTYLTKRQAlhMPNGQVAFQYYFSCSP 191 red flour beetle
XP_001948865 154 TITDKTRQFKLCEPIKMLPKCRYFRDMAWTLR-SEG--NGTLQTVHCHCPKGSVAYLLKRQAyqTESKQIGYQYSFACSP 230 pea aphid
EEB16297      53 TLTDKTRQFKLCEPVKKLPKCRFFRDMTWSLI-SNAD-NITEQIVHCHCPRGSVAYLIKRQAfqVNSG-IGYKYSFACSP 129 human body louse
XP_015789938  97 TIVDKTKQYKICESANKLPVCRHFRDVTWTLT-SFPD-NRTQQIMECVCPKNSIAYIFKHEAfqVGQG-IANRYLFACSP 173 two-spotted spi...
EDW30373     328 TIADKTRHYKMCQPVHKLPVCKHFRDYTWTLT-TAAEaNVTEQVVHCRCPRNSVTYLTKREP--IGDGSPGYRYLFACSP 404 Drosophila pers...
XP_011065265 138 TIADKTRRYKLCEPVKRLPICHYFKDITWTLApGGGPaNATVQRVYCRCRPNSVPYLVRRQPhkSPNGNHGFVYAFACSP 217 Panamanian leaf...
3C9A_A       146 LTRLRCQRKQPCKLFTVRKRQ-EFLDEVNINSLCQCPKGHRCPSHHTQSGV 195
EFA11599     192 QARLRCQRKEPCRLFTVRKRQ-EFLDEVNVNSLCQCPHAHRCPHHHMDYGV 241 red flour beetle
XP_001948865 231 QSRLRCQRKEPCRLFTVRKRQ-EMVDEVNTNTLCQCPPEHACPSHHTDAGV 280 pea aphid
EEB16297     130 QSRLRCQRKEPCRLFTVRKRQ-ERLEEVNTNTLCQCSHAHRCPKHHTDPGV 179 human body louse
XP_015789938 174 ESKMKCHRKEPCRLFTVMKR--TDFEEVNTSTLCNCGPRHYCPAHHIHPNV 222 two-spotted spider mite
EDW30373     405 LTRLRCQRKQPCKLFTVRKRQ-EFLDEVNINSLCQCPKGHRCPSHHTQSGV 454 Drosophila persimilis
XP_011065265 218 QSKIRCQHKEPCRLFTVRKRRnSQLEEVNASPLCQCPRGHRCPRRHTDPGS 268 Panamanian leafcutter ant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap