3B4Q


Conserved Protein Domain Family
DUF3235

?
pfam11574: DUF3235 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3235)
Some members in this family of proteins with unknown function are annotated as RpfA however this cannot be confirmed.
Statistics
?
PSSM-Id: 402945
View PSSM: pfam11574
Aligned: 14 rows
Threshold Bit Score: 49.7343
Threshold Setting Gi: 325554181
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3B4Q_A                   4 LNSAPTPRD-------------VVAN---------------APAPVQAAVAGAQEYAAQAGLNTEELAVDALYNAIKVRL 55  Coryn...
WP_015400241           117 LNSAPTPRD-------------VSASspaqs-----aaasaAPSQVQYVATQAEEQAAATGGSSDALAVDALYTLLRDTL 178 Coryn...
EGD23856               120 LSSAPSQRS-------------VPAT----------------PAPAPVTPAPVATTPAAPAAPSAVQAAFAGIDALLDAA 170 Rhodo...
WP_020934169           117 LNSAPTPRT-------------APTAtqs---------lpaANAPVQMMAANVAA-----GQTTDELAVDALFELLKDTA 169 Coryn...
WP_010187768           117 LNSAPTPRN-------------VSAApapaatqvkeetapqAPAEAPKAVHEAAE------EPTDELAVDALYTLIEDTA 177 Coryn...
PRJNA209048:CARG_02300 117 LSSAPTLRD-------------VQAA------------------PAVQAVERAVERAVEASSETSSLPSDALFKQLQDAF 165 Coryn...
CeBiTec:B843_04125     116 LNSASTPRS-------------VVGS---------------APAQVQAIVASAGD--------SSEAASDAVYNALKGRF 159 Coryn...
cebbi:ckrop_0433       119 LSSAPSQRDnayangaqaavqpAAAPveeaapaenaapaaqAPADVADEAPTPQKAVTDLAATQSIASLDQVFDAIQAAF 198 Coryn...
CAQ05527               163 LNSAPTQRD--------------------------------VPAKKAAPQATAKKAVSQLAQQKDVLAIDKVYQQIVERF 210 Coryn...
PRJNA235944:CFAL_02535 118 LNSAPTPRT-------------APGRp--------------AAAPAPAAAATPAAANQQLAQAATVGQLDDIYNGIVAQA 170 Coryn...
3B4Q_A                  56 AGTGLGIPPQIEAFYQANRT-NFNGFYXANRG 86  Corynebacterium diphtheriae NCTC 13129
WP_015400241           179 AQYGVVVPDFVEDIYNANRG-DFDAFYNANRA 209 Corynebacterium halotolerans
EGD23856               171 ANNGIVIHQDVLNAYDAAKSfDFNQVAMQNIA 202 Rhodococcus hoagii ATCC 33707
WP_020934169           170 AEYGVDVPAPVVDFYNANRH-DFNAFYAASRG 200 Corynebacterium maris
WP_010187768           178 TQYGLTIPASFTEQYKANRH-DFNAFYSANRH 208 Corynebacterium
PRJNA209048:CARG_02300 166 NRAGIQMPAFITSYYNANRS-EFNNFYNANRG 196 Corynebacterium argentoratense DSM 44202
CeBiTec:B843_04125     160 SAMGMPMPAQVDSFYNAYRG-DFNTFYTANRE 190 Corynebacterium vitaeruminis DSM 20294
cebbi:ckrop_0433       199 NKAGIPMPAVITDYYHAHHD-ELVGAYNQAIG 229 Corynebacterium kroppenstedtii DSM 44385
CAQ05527               211 EAAGLAVPAPVEEFYKAHRV-NLNNHLNAHNA 241 Corynebacterium urealyticum DSM 7109
PRJNA235944:CFAL_02535 171 RNAGVAVPQQVTDLYQSLRA-QLSNAVAPVAG 201 Corynebacterium falsenii DSM 44353
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap