6H02


Conserved Protein Domain Family
Med23

?
pfam11573: Med23 
Click on image for an interactive view with Cn3D
Mediator complex subunit 23
Med23 is one of the subunits of the Tail portion of the Mediator complex that regulates RNA polymerase II activity. Med23 is required for heat-shock-specific gene expression, and has been shown to mediate transcriptional activation of E1A in mice.
Statistics
?
PSSM-Id: 402944
View PSSM: pfam11573
Aligned: 17 rows
Threshold Bit Score: 1560.41
Threshold Setting Gi: 2498975
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6H02_A          6 QSIFEEVVKTEVIEEAFPGMFMDTPEdektKLISCLGAFRQFWGGL-SQESHEQCIQWIVKfIHGQHSPKRISFLY---- 80  
EFX89531        9 QALVSEALKVDAIEEAFNDFLIQRKDeg-iKYSALEKDLIAMMNDS-QAESQDAILPQFIAvISGVSSDSHSKILF---- 82   common water ...
Q5EB59          6 QSIFEEVVKTEIIEEAFPGMFMDTPEdektKLISCLAAFRQFWNGL-SQESHEQCVQWIVKfIHGQHSPKRISFLY---- 80   Norway rat
Q60UZ5         32 KSQIKSLIENNTTLRFFKPLTSNLGD----VTAILRISFNNMMSKM-EEKEKQSLVKELIKlVHHVAEKNTQDKVFiaas 106  Caenorhabditi...
Q10669         30 KSQIKSLVEENHTRKFFRPLTSNIGD----ETAILRIQFNNMMSKM-EEKEKQSLVKELIKmVHHVAEKNSPDRVFvgtn 104  Caenorhabditi...
EEB17621        9 TNIVNEILKVEGMEEAFSCFLVHRPDfeneKMEQFRSELQIALNNV-VPEQQEAGVRQFLLlAANMTNPSRLQFLL---- 83   human body louse
XP_001601066    8 TSILNEILKVEAIEEAFSCIIVHNPSnekeKIKGWQSELASVMAGL-GTEQQENAIRRFLYiAAEITNYKRMHLVL---- 82   jewel wasp
XP_008216794    8 VNILNDILKVEAIEEAFSCIIVHNTNnekaKITGWQTEMTNAMMGL-TTEQQENAIRKFLYtSAEITNYRRMHLIL---- 82   jewel wasp
XP_001951332   13 NQILNEIAKVDELVEAFNGYIQKDSLnnceQIEKLFMMLTNIVIRL-NDEQLSMSIKIILKtASTQTVSVRQKVFL---- 87   pea aphid
XP_015787237   15 HNFIDSILRTEELEAIFTGYIVESSVneecKIKNYEEQMTALIKSCdTPEKIELMLRDYLNgAGSIPNVNKVRLLL---- 90   two-spotted s...
6H02_A         81 ------DCLAMAVETG--LLPPRLVCESLINSDTLEWERTqLWALTFKLVRKIIGGVDYKGVRDLLKVILE-KILTIPNT 151 
EFX89531       83 ------KLLESVVNTN--IATSRKVCDSLLGNEKLTPANPlLWQGSFSLIRKIVCHVDYKGVREIMKTCLE-KAQLLPSR 153  common water ...
Q5EB59         81 ------DCLAMAVETG--LLPPRMVCESLINSDTLEWERTqLWALTFKLVRKIIGGVDYKGVRDLLKVILE-KILTIPNT 151  Norway rat
Q60UZ5        107 yervvdELLRYANQKE--VISTTLCVEGLIMTSDFRMCSR-IDQEKWKFIKECIPKIDYKGIRTIIRYILEsQLRRLPYQ 183  Caenorhabditi...
Q10669        105 yervvdQLLRYAHQKG--AISTNLCAEGLIMTSDFRLCSR-ICQEKWKFINDCIPKIDYKGIRNILRYILEsQLRRLPYS 181  Caenorhabditi...
EEB17621       84 ------QLLEGAVQSN--IVSARLVCECILSCDKLSLNNQdFWVQCFQLMRKIIVGVDYKGVREIMKGCRE-KAAVIPAK 154  human body louse
XP_001601066   83 ------SLLENLVSTN--VLPARLVCECIFGCEKLQYQNKeFWVECFTLIRHIIGGVDYKGVREILKACEE-KAHILPVM 153  jewel wasp
XP_008216794   83 ------TLLEKLVSNN--VLPARLVCECILSCDKLKYQNEeFWIKCFTLVRHIIGGVDYKGVRDVLKACRE-KAHSLPTR 153  jewel wasp
XP_001951332   88 ------NMLQKLVQKH--GVSSRLMCECIINSEYLVHTNSeFWIECFHIIKSILDTVDYKGVREILKGCFD-KVVAMPKA 158  pea aphid
XP_015787237   91 ------SM--LEHAinnhllSAKSVCEAILNCEHLHINKQiFFCQSFELIHRVISQVDYKGVRDIIRFMIE-KIHTIPIE 161  two-spotted s...
6H02_A        152 VSSAVVQQLLAAREVIAYILERNACLLPAYFAVTEIRKL-YPEg-kLPhwLLGNLVSDFVDTFRPTARINSICGRCSLLP 229 
EFX89531      154 FSTSEYPNVTALEHTLKHILDRQVCLLPAYFIVNEIRKM-YPEnkdWPhwKLAGLLSEVVDSFRPLVQMLSPIGRPLMFP 232  common water ...
Q5EB59        152 VSSAVVQQLLAAREVIAYILERNACLLPAYFAVTEIRKL-YPEg-kLPhwLLGNLVSDFVDTFRPTARINSICGRCSLLP 229  Norway rat
Q60UZ5        184 LSPEKVNELRRVEDVLLKIVDRDLNLMPPLITLSEVMRGtPKQahmFP--RLTEKLANLSSHFRPIADLTHVCGRPFIYP 261  Caenorhabditi...
Q10669        182 LSPEQVNEIRIVENVILHIVDRDSNLMPPLITLSEIMRGmPKQalmLP--RLTEKLASLSVHFRPIADLSHVCGRGFVYP 259  Caenorhabditi...
EEB17621      155 LNAAQMPQITALESVMEFIFDRNACLLPAYFIVNEIQKA-YPEnknWPhwKLANLLSGFVESFRPCAQMVSIVGHSKLLP 233  human body louse
XP_001601066  154 IDASVQSQMKACEHLIEYIFDRNACLIPCYLIVNELQKF-AADkknWPhwKLAKLISNFIDSFRNVVQMISIIGHSKMLP 232  jewel wasp
XP_008216794  154 LDASVQPQMKALENLVEYIFDRNACLIPSYLIIDELEKN--AEnkiWPh-wLAKLISNFVTSFRNVVQIVSIIGHSKMLP 230  jewel wasp
XP_001951332  159 LPASILPQFLALEEVIRYIFDRESCLLPGYFVINEILKV-YSEnkgWPhwKLGCLVSNFVESFRGAAQMTSMIGHSSMLP 237  pea aphid
XP_015787237  162 ANIAMLPQLDVMRKVLDYALNRNSSLLPAYLAFDEIKKKsd----kWMhwKFADLFSAFVESFRPVAQMVSIINRSKLLP 237  two-spotted s...
6H02_A        230 VVNNSG---AICNSWK---LDPATLRFPLKG--LLPYDKDLF-EPQTALLRYVLEQPYSRDmvcnmlGLNKQHKQRCPVL 300 
EFX89531      233 VVDPSAhgvH--HSWK---LEQGTLKLALKG--NLPYEKEYT-EPQTRLIRYVLEQPYSREvlcgmlGLQKQHKQRHAVL 304  common water ...
Q5EB59        230 VVNNSG---AICNSWK---LDPATLRFPLKG--LLPYDKDLF-EPQTALLRYVLEQPYSRDmvcnmlGLNKQHKQRCPVL 300  Norway rat
Q60UZ5        262 IPFHPAf-hPPTSYWEdfgMNAQSPYTQSHH--MLPYRPQHKaASCLYTFYMILRQPLGKD------SLNPTNRNKTKSH 332  Caenorhabditi...
Q10669        260 IPLHPSf-yPLTSCWEehgLNASNTIVQPHH--TLPYRPEHT-STYLYTLYMILRQPLGKD------SLHPPSKTKTKTN 329  Caenorhabditi...
EEB17621      234 VVEHSGyadHL-SPWK---LDPTTLKFTLKG--ILPYDRELS-EPQTGLLRYVLEQPYSRDmvccmlGLVKQHKQRCVAL 306  human body louse
XP_001601066  233 LVEHSGygdHLVSPWL---LDRNTLQFSLKGleSLPYDPELL-KPQTNLLRYVLEQPYSRDmvcsmlKLQKQQNLRCKAL 308  jewel wasp
XP_008216794  231 VVEHTGygdHSVTPWV---LDRNTLQFTLKG--NLPYDPELL-KPQTDLLRYVLEQPYSRDmvcsmlGLQNKQNTRCAAL 304  jewel wasp
XP_001951332  238 VVEHSGyadHLITPWK---LDPNTLKLTLKG--NIPYPKQLL-QPQTKLLRYVLEQPYSRDmvcsmlGLQKMNKQRCIVL 311  pea aphid
XP_015787237  238 IV---GyssTLNQSWQ---LNAATAAFDLKG--LLPYNNELT-RPQIGLLRYVLEQPYSREmiyfmlSLTNKAKSRCPIL 308  two-spotted s...
6H02_A        301 EDQLVDLVVY-AMERSEtee-----kfDDGGTSQLLWQHLSSQLIFFV---LFQFASFPHMVLSLHQKLAgrgLIKGRDH 371 
EFX89531      305 EEQLVELLVQ-AMERAEiapeqdsdaaDELGVSHWLWHHLSSQIIYFV---LFQFASFSHLVTLLHEKLAerkLRKGRDQ 380  common water ...
Q5EB59        301 EDQLVDLVVY-AMERSEtee-----kfDDGGTSQLLWQHLSSQLIFFV---LFQFASFPHMVLSLHQKLAgrgLIKGRDH 371  Norway rat
Q60UZ5        333 WEPLLSVMIVeAMAETEal-------pEGKQIPRYQWDNITNLVMYGMshlLVNPKNFFHYLKGLINQCK---YTRARDE 402  Caenorhabditi...
Q10669        330 WEMLISVMICeSMAEAEsl-------pETEPIPRYQWDNIVNIVIYGItqhLLVPKTFFNVLKNLIKRCK---YTRARDE 399  Caenorhabditi...
EEB17621      307 EEQLVALVVV-AMERSEt---------ETGDSSHWLWLHLSSQLIYFV---LFQFASFPNIVMALHDKLSgrdLKKGRDH 373  human body louse
XP_001601066  309 EEQLVDLMIR-NMEKSEneptp-addsDGVITNFWPWLHLSSQLIHYV---IFQFVSFPSLITAIHDRLAgreWKKARDH 383  jewel wasp
XP_008216794  305 EEQLVDLVIR-TMEKSEneptp-vegvDGVTTNHWPWLHLSSQIICHV---LSQFASFPSFVTAIHEKLAgreWKKSRDH 379  jewel wasp
XP_001951332  312 EEQLVELIIR-SMEKSDkev----tegADPEENHWLWLHISSQLIYFI---LFQFAVFPNVVNALHEKLLkkdLHRSRDR 383  pea aphid
XP_015787237  309 EEQLVALIVL-AMEKSEnetn--nqedTDYSQTQCLWQILSGHLITFI---ILNHISFPQLVRSLHESLAarnSKKGRDH 382  two-spotted s...
6H02_A        372 LMWVLLQFISGSIQKNALADFLP-VMKLFDLLYPEKE-YIPVPDiNKPQSTHAFAMTCIWIHLNRKAQNDnsklQIPIPH 449 
EFX89531      381 LMWVLLQYISGSIQKNPLAEFLP-LLRLYDLLYPERE-PLPVPDyTRPICVHQMAVACIWIHIVKKAQTEqqklQRHFPQ 458  common water ...
Q5EB59        372 LMWVLLQFISGSIQKNALADFLP-VMKLFDLLYPEKE-CIPVPDiNKPQSTHAFAMTCIWIHLNRKAQNDnsklQIPIPH 449  Norway rat
Q60UZ5        403 VMWIVFQVVSSLHKMIKIEDAVQeIVDLYNELFDGEFsWHGASD-HPARMARFLAAASTWMLLEKNKAHKqn------tD 475  Caenorhabditi...
Q10669        400 VMWIVFQVVGSLSNLTRLDDAVTeIVELYNELFDGDVvWMGASD-HPALFARFLAAAGTWMILEKDFADK----MPPANE 474  Caenorhabditi...
EEB17621      374 LMWVLLQFISGSIQRNPLSNFLP-VLKLYDLLYPEKE-PLPVPDvNKAVCTHQMAMTCIWIHLLKKAQADhlniQRPIPL 451  human body louse
XP_001601066  384 LMWVLLQFISGSIQRNPLTTFLP-IFKLYDLLYPEKD-PLPVPDlTHIKCTHEMALICIWLHLLRKAQTEnsncHRPIPH 461  jewel wasp
XP_008216794  380 LMWVLLQFISGSIQRKPIAVFFP-IFKLYDLLYPEKD-PLPVPDlTQSICAHQMACVSIWLHLVKKIHPDhtnfHKLIPY 457  jewel wasp
XP_001951332  384 LMWVLLQYISGSIQRNSLENILP-VLKLYDLLYPEKE-PLPVPDtSNALCTHQMAITCIWIHLLRKALMDnikfHRPIPL 461  pea aphid
XP_015787237  383 LMWMLLQYISGSIQKTPLTDFLP-FFKLHDLLYPEKD-PLPVPDiTKPICTHTFAISSIWIHLLKKAENEpqkmIRPIPN 460  two-spotted s...
6H02_A        450 SLRLHHEFLQQ-SLRNKS--LQMnd-ykIALLCNAYSTN--SECFTLPMGALVETIYGNGImriplpg------------ 511 
EFX89531      459 ALKNHQEFLQHnALNPPS--SAPsgdyrVALLCNAFSTT--LDCLARPMGSLMESLHGNLSqkgsgnagg---------- 524  common water ...
Q5EB59        450 SLKLHHEFLQQ-SLRNKS--LQMnd-ykIALLCNAYSTN--SECFTLPMGALVETIYGNGImrvplpg------------ 511  Norway rat
Q60UZ5        476 TIKSHIKVIHEaALNFDPknMGM-----LAVLANAFKSD--TRIGAQIVPAMSEALNTPPD------------------- 529  Caenorhabditi...
Q10669        475 TIKSHIKFIQDgVDNFDSsnTAM-----LAVLSNIYRTD--TKMGKLIVPTLQQMLESIDD------------------- 528  Caenorhabditi...
EEB17621      452 TLKIHHEFLQHlVQPNNSlgLCMgadyrIALLCNAYSTN--QEYFTRPMAALVETILGAQKsssl--------------- 514  human body louse
XP_001601066  462 NLKMHNEFLQHaVTQPN---LAMgtdyrIVLLCNAYSTQtaNDYFTRSINVLFESI---QKshpqqplqnl--------- 526  jewel wasp
XP_008216794  458 NLKTHHEFLQHmAVQNTP--LSMgsdykIALLCNAYSTS--NELFSRPMSVLVESVLGTQKnqqqqplqnl--------- 524  jewel wasp
XP_001951332  462 ALKAHHEYLQMlVQPSNSa-LCMgtdyrVPLLCNAFSTN--NECLSRPMAALVDAVLGSSSnrgisgvtsntqqstqspv 538  pea aphid
XP_015787237  461 CLRLHVEFLHQtFMSSDLp-ASLtvdskIPLICNAYSTN--SDYYNRILTILCDTIKCNSRsgstg-------------- 523  two-spotted s...
6H02_A        512 ----------------------------tncmasgSITPL----------------PMNLLDSLTVHAKMSLIHSIATRV 547 
EFX89531      525 --------------------------saggmpntgPISPI----------------PLAFLDALTVHAKMSLIHSIVTHV 562  common water ...
Q5EB59        512 ----------------------------tsclasaSVTPL----------------PMNLLDSLTVHAKMSLIHSIATRV 547  Norway rat
Q60UZ5        530 -----------------------------------PSQPTfdlsyqrkavnqfdafPKEFLDALTSRAKRSLLGQILSVF 574  Caenorhabditi...
Q10669        529 ------------------------------------TKSLfelsykrmavncfsafPVEFMEALTFRSKKTLLIQCFQPL 572  Caenorhabditi...
EEB17621      515 --------------------------------ppgPTTPL----------------SMAILDSLTVHSKMSLIHSIVTHV 546  human body louse
XP_001601066  527 --------------------------qsntsivhhPTTPL----------------SMSILDSLTVHAKMNLIHNIVQHM 564  jewel wasp
XP_008216794  525 --------------------------qnnsalsnsPTAPL----------------PMSILDSLTVHVKMSLIHSILTHV 562  jewel wasp
XP_001951332  539 itpavggtspvasvpgsggttspisgnasssnamgPTTPL----------------SMAVLDSLTIHAKMSLIHSIVTHV 602  pea aphid
XP_015787237  524 ------------------------------gntngAIIPL----------------SVSLLDSVTLHTKMSLISNIVAQI 557  two-spotted s...
6H02_A        548 IKLAHAKSsvaLAPALVETYSRL-------LVYMEIESLGIKGF-----ISQLLPTVFKSHAWGILHTLLEMFSYRMHHI 615 
EFX89531      563 IKCAQTKMnvpLAPALVETYSRL-------LVYTEIESLGIKGF-----ITQVMTSVSKSQAWGIFHTLVEMFTFRVHHM 630  common water ...
Q5EB59        548 IKLAHTKSsvaLAPALVETYSRL-------LVYMEIESLGIKGF-----ISQLLPTVFKSHAWGILHTLLEMFSHRMHHI 615  Norway rat
Q60UZ5        575 RSFGTDKL---PSPAAFETLARIcqsedyeMAVKDLESLASRSLhi-stQERAADIATNNQAKDQCHFLFDFLAYRLPHV 650  Caenorhabditi...
Q10669        573 RSFSTVRL---PSPAVFETVAKIcesedyeMAVKDMEHLAQRSLhvataADRSSGEHQNVQAKDQCYFLFDFLVYRLPHL 649  Caenorhabditi...
EEB17621      547 VKQAQSKSilaLAPALVETYSRL-------LVYTEIESLGIKGF-----ISHLLPTVFKHHAWGILYTLLEMFSYRMHHI 614  human body louse
XP_001601066  565 MKNAHSKSnmtLPPALVETYSRL-------LVYTEIEVMGIKSF-----INQLLPTIFKAHAWGTLYTLLDMFSYRMHHI 632  jewel wasp
XP_008216794  563 AKSASTKSnlpLPPALVETYSRL-------LVYTEIENIGIKKF-----ISHLLPTVFKAHAWGILYTLLDMFSYRMHHI 630  jewel wasp
XP_001951332  603 LKLAQSKSnlaLAPALAETYSRL-------LVYTEIESLGIKGF-----ISQVLPTVFKSHAWGILYTLLEMFSYRMHHI 670  pea aphid
XP_015787237  558 NKSSSKDGt-iISPALAETYSRL-------LIYIELETLGIKNF-----IQQVIPNAIRTQSWGTLNILFEMFIHRLHHI 624  two-spotted s...
6H02_A        616 QPHYRvqLLSHLHTL---------AAVAQTNqnQLHLCVESTALRLI-------------TALGSSEVQ--PQ---FTRF 668 
EFX89531      631 QPQYRiqLLTLLHSC---------A-VPQQHqtQLILCVENAALRLI-------------GLLGAAEMQ--PC---YSRS 682  common water ...
Q5EB59        616 QPHYRvqLLSHLHTL---------AAVAQTNqnQLHLCVESTALRLI-------------TALGSSEVQ--PQ---FTRF 668  Norway rat
Q60UZ5        651 HSYGK--YTSTTGSLllyftasvaPNTPQNH--QVYRLLEQALLRRMywrtfhesvinhsQLFGSSYKE--NSnnvMLRH 724  Caenorhabditi...
Q10669        650 HAYSK--YSSTVNALsyft--qhiPNNPQNH--QIYRLMEQFLMRRWcwagfhgcitahtQMFGTSYKD--NT---MMRH 718  Caenorhabditi...
EEB17621      615 QPHYRvqLLSHLHSL---------AAVPQTNqtQLHLCVESTALRLI-------------TGLGSAEVQ--PQ---LSRF 667  human body louse
XP_001601066  633 QPTYRvqILSHLHNL---------ASVPQTNqtQLHLCVESTALRLI-------------TGLGSAEVQ--PH---LSRF 685  jewel wasp
XP_008216794  631 QPTYRvqILSHLHSL---------ASVPQTNqtQLHLCVESTALRLI-------------TGLGSAEVQ--PH---LSKF 683  jewel wasp
XP_001951332  671 QPHYRvqLLSHLHSL---------AAVPQTNqtQLHLCVESTALRLI-------------TGLGSNEVQ--PQ---LSRF 723  pea aphid
XP_015787237  625 PAPYRvqFLNQLHYL---------ANSPHSNqiQLHSCMESTALKLI-------------TGFTSEQVLliTQ---LNRY 679  two-spotted s...
6H02_A        669 LSDPKTv--L-SAESEELN----RALILTLARATHVTDfftgsdsi-qgtwckdiLQTIMSFTPH-------NWASHTLS 733 
EFX89531      683 AADIKP---LfSSDSEELN----RALILTLARVISVAGcetqhs-----swykdlLTLIQQQTPH-------SWSSNTRD 743  common water ...
Q5EB59        669 LNDPKT---VlSAESEELN----RALILTLARATHVTDfftgsdsi-qgtwckdiLQTIMTFTPH-------NWASHTLS 733  Norway rat
Q60UZ5        725 LKNPKTfstPvDQWQFPLNpeifKMTIYAFMRALKITG-----------------QEIPLDGTMHpihvagyGWPEKSTT 787  Caenorhabditi...
Q10669        719 MAYPKTfsvP-DQYPFAINpeifKMAIYSFLRAVKITA-----------------QDIAIEKTMFptiingfGWPEKSTS 780  Caenorhabditi...
EEB17621      668 LNEPKT---LvSAESEELN----RALVLTLARSMHVTGtgsdsis---gtwckelLSTIMQNTPH-------SWANHTLQ 730  human body louse
XP_001601066  686 LSEPKT---LiSADSEELN----RALVLTLARSMHITGtgadtvs---gtwcqdlLNTIMQNTPH-------SWADHTLQ 748  jewel wasp
XP_008216794  684 LSEPKT---LvSADSEELN----RALVLTIARSMHITGtggdtnrdvnsiwckdlLNTIMQNTPH-------SWAEHTLR 749  jewel wasp
XP_001951332  724 LSEPKT---LvSAECEELN----RALVLTLARSMHITGtsasqeg----swckelLTTIMANTPH-------TWAPHTLQ 785  pea aphid
XP_015787237  680 QNEPKI---RiSHDSEELN----KVLILTLARAIHVTGcdtlie------wckelLSNIMNSTPL-------AWSSCTLK 739  two-spotted s...
6H02_A        734 CFPGPLQAFFKQ--NNVPQE--SRFNLKKNVEEEYRKWKSMSnENDIITHFSMQ-GSPPLFLCLL-------WKMLLET- 800 
EFX89531      744 CFPPPLAEFFGQaaNQPVKE--SKQQLKQNIEEEHRKVLTMn-PDDWPAHFAPQsNNPPFFLCLL-------WKQLLET- 812  common water ...
Q5EB59        734 CFPAPLQAFFKQ--NNVPQE--SRFNLKKNVEEEYRKWKSMTdENEIITQFSMQ-GFPPLFLCLL-------WKMLLET- 800  Norway rat
Q60UZ5        788 FFPKWALEEIKK--TDVKKLapNYAEILSTTDEAFRMNTLLT-GGQYVIRYADD-PNPITYHCMLav----iFKQLCSKp 859  Caenorhabditi...
Q10669        781 YFPKWALDAIKA--SDTSNAv-NTEEILSDVRNTARMHTSLT-PNQFVIRYGED-RDPATSHCMLavlfhfaYNSVDST- 854  Caenorhabditi...
EEB17621      731 CFPLALHDFFQH--SPVQKE--NKPQLKKAVEEEYRNWASMNnENDIIAHFSVA-GTPPLFICLL-------WKMILET- 797  human body louse
XP_001601066  749 CFPPILSEFFQQ--NSVPKE--EKQQIKKAVEEEYRNWASMSnENDIIAHFSVS-GSPPLFLCLL-------WKMIIET- 815  jewel wasp
XP_008216794  750 CFPPALSEFFQQ--NSIPKE--EKQQIKKAVEEEYRNWASMSnENDIIAHFSVP-NSAPLFLCLI-------WKMILET- 816  jewel wasp
XP_001951332  786 CFPPALADFFVH--NPITKE--NKQQLKKAVEEEYRNWASMTnENDIIAHFSVP-TAHPLFLCLL-------WKMIIET- 852  pea aphid
XP_015787237  740 CFPPAITEYYQN--FNTVTE--NKAQLKQSVEEEYRKWITMSnENDIIAHFSIQ-GTPPLFLCLL-------WKMILEN- 806  two-spotted s...
6H02_A        801 -DHINQIGYRVLERIGARALVAHVRTFADFLVYEF--STSAGGQQLNKCIEILNDMVWKYNIVTLDRLILCLAMRSHEGN 877 
EFX89531      813 -ERINPVAYKCIERIGARGLGSHLRTFCDFLVYEF--ANSGKGQHVNKCIDVLNEMVWQYNVVTIERLVLCLALRPLEGN 889  common water ...
Q5EB59        801 -DHISQIGYKVLERIGARALVAHVRTFADFLVYEF--STSAGGQQLNKCIEILNDMVWKYNIVTLDRLILCLAMRSHEGN 877  Norway rat
Q60UZ5        860 eQDLTSEYYQVMEKKSPKDIVVMGNYLVDFIIADVknNQDCNEQTFKTIAKTAALMCFHFNIHRADRFLLSLIMHPSTDE 939  Caenorhabditi...
Q10669        855 -YNITSEFYEVMEKKTPKEIVVMGNYLVDYIIADAk-TQDCNEKTFKNIAKAAALLVFQFQVLRADRLLLSLIMHPATDE 932  Caenorhabditi...
EEB17621      798 -DRITSIAYKILERIGARALSAHLRKFCDYLVFEF--ANSRGEQHVNKCVDALNDMIWKYNIVTIDRLVLCLALRTQEGS 874  human body louse
XP_001601066  816 -DRISPIAYKILERIGARALSAHLRKFCDYIVFEVs-SIAADGSYVNKGVDAINDMIWKYNIFTFDRLVLCLALRTLEGN 893  jewel wasp
XP_008216794  817 -DRVNPIVYKILERIGARALSAHVRKFCDYIVFEVs-STAADGIYVNKSVDAINHMIWKYNIVTFDRLVLCLALRTLEGN 894  jewel wasp
XP_001951332  853 -DRINPIAYKILERIGARALSAHLRKFCDYLVFKF--AVSEEGQHVNKCVDAINSMIWKYNIVTIDRLVLCLALRTQEGS 929  pea aphid
XP_015787237  807 -DRINPIAYKILDRIGAKALSSHLRILVDYLVNEF--TNLCGTQNVTKYIDKLNDLIWKSHVITLDRLLLCLTLRAYEGN 883  two-spotted s...
6H02_A        878 EAQVCYFIIQLLLLkPNDFRNRVSDFVKeNSPEHWLQNDWHTKHMN-YHKKYPEKLY-FEglae---qvdPPvqiQSPYL 952 
EFX89531      890 EAQVCCFIIQLLLLkTPQFRSRVQDFVKdNSSEHWRQNNWHEKHLA-FQRKFPERFGpPEsvle--sigqGG---SYQSL 963  common water ...
Q5EB59        878 EAQVCYFIIQLLLLkPNDFRNRVSDFVKeNSPEHWLQSDWHTKHMS-YHKKYPEKLY-FEglaeqvdppvPI---QSPYL 952  Norway rat
Q60UZ5        940 DAQICIQIANEFLL-TPKFQERIKWFYEnDVPRKEKDPYEYIKAIVkYHDAFPEFEA-CQlvpk---nddTG---TNVHM 1011 Caenorhabditi...
Q10669        933 DALICIQIANEFIL-TPEFQERIRWYHQ-NVPKKDHFPTEYIKAIVkYHDAFPEFEA-CElvr----sydSS---SNVHM 1002 Caenorhabditi...
EEB17621      875 EAQVCFFIIQLLLLkAAELRNRVQDFVKeNSPEHWKQSNWHEKHLA-FHRKYPEKFA-PEgileq-sggaSS---PYHSL 948  human body louse
XP_001601066  894 EAQVCFFIIQLLLLkAAEFRNRVAEFVKeNSPDHWKQSNWHEKHLA-FHRKFPEKFA-PEgimeq-asgsPN---QYQSF 967  jewel wasp
XP_008216794  895 EAQVCFFIIQLLLLkATEFRNRVVEFVKeNSPDHWKQSNWHEKHLA-FHKKFPEKFA-PEgmmdq-ssgsPN---QYQSF 968  jewel wasp
XP_001951332  930 EAQVCFFIIQLLLFkGAEFRARVCEFVKeNSPEHWKQSNWHEKHLA-FHRKYPEKFA-PEgi------ldPA---SYQPL 998  pea aphid
XP_015787237  884 EAQVSLFIIQMLLLkTTDFSNRVADFVReMSPEHWKQSNWHEKHHA-LHRKYPEKFY-FEglad--isgqNM---QHSYL 956  two-spotted s...
6H02_A        953 PiYFGNVCLRFLPVFDIVIHRFLEllPVSKS--LETLLDHLGGLYKFHDRPVTYLYNTLhYYEMHLRDRAFLKrKLVHAI 1030
EFX89531      964 PtYFGNVCLRFLPVFDITIHRFTEipPVTKS--LETILEHLGCLYKFHDRPVTYLYTTLhYYERKLRDRPLLKrKLVSSI 1041 common water ...
Q5EB59        953 PiYFGNVCLRFLPVFDIVIHRFLEllPVSKS--LETLLDHLGGLYKFHDRPVTYLYNTLhYYEMCLRNRDHLKrKLVHAI 1030 Norway rat
Q60UZ5       1012 PtYYGCLIERLLPILDQYVYVALEq-QGYKM--SNALLQLVSMFYRYHPMPIHFMYSVL-FVSHGKMAGPDAK-SFVSAF 1086 Caenorhabditi...
Q10669       1003 PtYYGCLIERLLPIMDQYLHVALEq-QGYKL--NPQILQSVSMLYKFHAMPIHFMYSVL-FTSHGLMSGPDAK-SFVLAF 1077 Caenorhabditi...
EEB17621      949 PvYFGNVCLRFLPVFDIVIHRYLElpPVTKS--LETLLEHLGCLYKFHDRPVTYLYNTLhYYDRNLRDRPVLKrRLVAAI 1026 human body louse
XP_001601066  968 PaYFGNVCLRFLPVLDIVMHRYLEipQVTKS--LEVLLEHLGCLYRFHDRPVTYLYNTLhYYERQLRDKPILKrRLVIAI 1045 jewel wasp
XP_008216794  969 PaYFGNVCLRFLPVLDIVMHRYLEvpQVTKS--LEVLLDHLGCLYRFHDRPVTYLYNTLhYYERKLRDQHFLKrRLVTAI 1046 jewel wasp
XP_001951332  999 PvYFGNVCLRFLPVFDIVIHRYLElpPVTKS--LETLLDHLGCLYKFHDRPVTYLYNTLhYYESKLRDRPSLKrKLVYAV 1076 pea aphid
XP_015787237  957 PtYFSNICLRFIPVLDLIIHRYLElpPGSPSplIDSLLEKYGCLYKFHDRPLTYLYETLhYYEHKMRERPALRrKLVSII 1036 two-spotted s...
6H02_A       1031 IGSLKDnrpqgwcLSDTYLKC------------AMNAREEnpwvp------ddtyyCRLIGRLVDTMAGK-SpgPFPNCD 1091
EFX89531     1042 MGSLKDvrppgwaLSESYLNY------------STRQADDlnwlp------eldyyVKLVGRLVDTTAGR-SpfPFPAMD 1102 common water ...
Q5EB59       1031 IGSLKDnrpqgwcLSDTYLKH------------AMNAREDnpwvp------edsyyCKLIGRLVDTMAGK-SpgPFPNCD 1091 Norway rat
Q60UZ5       1087 ASQIEEc-----hLTEEFEKYn-----------HQKSSCEel-------------iMELLDRMAASLDFVlTppTFVAKD 1137 Caenorhabditi...
Q10669       1078 ATQIEEc-----hLTEAFEKFn-----------HQKSSREql-------------iMELIDRMSASLDFIlTppPFVAKD 1128 Caenorhabditi...
EEB17621     1027 LGALKDirppgwsLSEAYINY------------MSGSGDEvswlp------dldyyIKLIRRIVETMNGSkA--HFPSTD 1086 human body louse
XP_001601066 1046 LGSLREtktpgwaLSDAYQRY------------IARAPDDlawqp------eldyyVRLVQRLVDTIYGT-I--QFPPTD 1104 jewel wasp
XP_008216794 1047 LGSLKEirapgwaLSEAYQRY------------TARSTDDvkwqp------eldyyVRLVQRLVETISGR-A--QFPSTD 1105 jewel wasp
XP_001951332 1077 LGSLCEtrg-cwtLSESYQRYniqtptstisnsMGTSTDVtvtpsapiwvpdleyyVMLVKRITDTMNGN-V--KFPNID 1152 pea aphid
XP_015787237 1037 IGAFKDikpanwaVTDAYLNY------------MKRPVEDlawnp------eldyyFKLISRVVDTFQGK-S--PFPHVD 1095 two-spotted s...
6H02_A       1092 WRFNEFPnPAAHALHVTCVELMALAVSGKEVGNALLNVVLKSQPLVPRENit---awMNAIGLIITALPEPYWIVLHDRI 1168
EFX89531     1103 WRFNEFPnASCHALYVTAVELLALPASPAIVANALMDVVLQGYNLLPVSEetpleswVNAVGLLLTYLPESYWSVLYDRI 1182 common water ...
Q5EB59       1092 WRFNEFPnPAAHALHVTCVELMALAVPGKDVGNALLNVVLKSQPLVPRENit---awMNAIGLIITALPEPYWIVLHDRI 1168 Norway rat
Q60UZ5       1138 WRTAEMS-PGAQALYLACIELMASPHSPEKLVNAMINVMQMRPHLRPFNV-------FNLIALLLTALPSTYADALHEEF 1209 Caenorhabditi...
Q10669       1129 WKIAELS-PGAQTLYLACIELMASPHSPETLVAAMINVMQMKPHARPFNI-------VNLTALLLTALPAAYSNALHDEF 1200 Caenorhabditi...
EEB17621     1087 WRFNEFPnPAAHALYVTCVELMAVPVSPSVVANNLLDVVTKGYSVIPWDQih---lwINSIGLVLAALPESYWSIVDDRL 1163 human body louse
XP_001601066 1105 WRFNEFPnPAAHTLYVTCVELMALPVAPNVVANNLLDVVAKGYTVIPSDEih---swINCIGIIMSALPECYWSILHERL 1181 jewel wasp
XP_008216794 1106 WRFNEFPnPTAHTLYVTCVELMALPVAPNVVANNLLDVVAKGYTIIPSDEih---vwINCIGIIMTALPECYWSTLHDRL 1182 jewel wasp
XP_001951332 1153 WRFNEFPnPAVYALYMTCAELMALPLTPASVANSLLDVVMQRYTEIPSHEih---cwINSIGLIMSAMPEPFWVTLQDRI 1229 pea aphid
XP_015787237 1096 WRFNEFAnAGVHALHITCIELMALPVAANVVANNLIDLVVVGHKYIPRNTie---fwNNAIGVVLTALPEAYWSVINDRI 1172 two-spotted s...
6H02_A       1169 VSVISspSLTSEtewvgyPFRLFDFTACHQSY---SEMSCSYTLALAHAVWHHSSIGQLSLIPKFLTEVLLPIVKTEFQL 1245
EFX89531     1183 VELLSgpQLSTYtyp-csPLHLFHFSTVVGQG---LDAPFVLLLAVSHAFFTHANIGQMGGLPQFVKDRLHPLIRTEEQY 1258 common water ...
Q5EB59       1169 VSVISssSLTSEtewvgyPFRLFDFTACHQSY---SEMSCSYTLALAHAVWHHSSIGQLSLIPKFLTEVLLPVVKTEFQL 1245 Norway rat
Q60UZ5       1210 IGVFKngETANL------KFEEIVFDNYDSSLllhLPNRARSINMIAQIYWTQCNMALLNPFANDQVPKLLEHVKTEKDL 1283 Caenorhabditi...
Q10669       1201 VAVFVngETANL------KFEEIVFDNYEESLllnLPNRARTINVISQQYWLHCSLSLLNFFSHEYVPRILEHVKTEKDL 1274 Caenorhabditi...
EEB17621     1164 IEVMTcsRMTNWpyh-nsAFQIFNFSVTHESL---LENKFSYILALAHAMWYHAGVGQISTLPVFVKEKAKTVIKTEEQF 1239 human body louse
XP_001601066 1182 VQTASssGLVNWqydnlsPFQLFNFNLTHNSF---FENKYSYMLALAHSIWHHAGVGQMFTMVQFIKEKLQPVINTEEQL 1258 jewel wasp
XP_008216794 1183 VETITspGLTSWqydnlsPFQLFNFNLTHNSF---LENKYSYMLALAHSIWHHAGVGQITAMTRFVKERIQPVVNNEEQL 1259 jewel wasp
XP_001951332 1230 MQMMQspGLATWhya-htPFQLFNFDLAHGCM---LDNRFIYMLALAHATWHHAGVGHIASIPLFVKEKLGPSVYSEEQF 1305 pea aphid
XP_015787237 1173 ISMMEspLLTYSph--pePFQMMNFSDSHKSM---SEMQPSYLIALIHSFFHHASIGQITPIPQFLRERVKPIIKTEEQF 1247 two-spotted s...
6H02_A       1246 LYVYHLVGPFLQRF----------QQer-trCMIEIGVAFYDMLLNVDQCSTHLNYMDPICDFLYHMKYMFTG 1307
EFX89531     1259 LWLCHLIGPTLQRF----------SVdk-pkCVFDLTVELYELLEQVDKNVAEIRMIDPICDLLYHIKYMFTG 1320 common water flea
Q5EB59       1246 LYVYHLVGPFLQRF----------QQer-trCMIEIGVAFYDMLLNVDQCSTHLNYMDPICDFLYHMKYMFTG 1307 Norway rat
Q60UZ5       1284 WYTLRLVMPIIRRFwdswdfaktmRAlrerfGPLVIMKLIIEKLGSMAESGVEIVHEAPFCDLFYNCKYVFVG 1356 Caenorhabditis briggsae
Q10669       1275 WYTLRLVMPYLRRYyenwdtakqmRSqrenfGPLHIVKLVFQKLGSMAEEGVEIVYEQHLCDLFYNCKYFFAG 1347 Caenorhabditis elegans
EEB17621     1240 LFLCHLVGPFLQRL----------NAer-prCVLELTIELYELLEQVDKSVLQLKYMDPICDLLYHIKYMFVG 1301 human body louse
XP_001601066 1259 IFACHLIGPTLNRF----------NSer-pkCITDLTIMLYEMLEQVNRAQTHLRQMDPICDLFYHIKYMFVG 1320 jewel wasp
XP_008216794 1260 IFVCHLIGPTLTRM----------NIer-prCVNDLTEILYEMLEQVNRLQTHLKQMDPVCDLFYHIKYMFVG 1321 jewel wasp
XP_001951332 1306 IFLCHLVAPFLSRY----------NLdkpspSIVDVTVELFNALERMDKHVQTLHYMDPICDLLYHIKYQYVG 1368 pea aphid
XP_015787237 1248 LFIVHIVCPFLQRL----------YAer-trRAMEVTIELYSFLEVIDKNCTELRFMDTITDLLYHMKY-HIT 1308 two-spotted spider mite
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap