2V0X


Conserved Protein Domain Family
LAP2alpha

?
pfam11560: LAP2alpha 
Click on image for an interactive view with Cn3D
Lamina-associated polypeptide 2 alpha
LAPs are components of the nuclear lamina which supports the nuclear envelope.LAP2alpha is a non-membrane-associated member of the LAP family which is unique. This family of proteins is the C terminal domain of LAP2alpha which consists of residues 459-693 and constitutes a dimeric structure with an antiparallel coiled coil. LAP2alpha is involved in cell-cycle regulation and chromatin organisation and preferentially binds to lamin A/C.
Statistics
?
PSSM-Id: 371604
View PSSM: pfam11560
Aligned: 2 rows
Threshold Bit Score: 467.63
Threshold Setting Gi: 151568105
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2V0X_A   1 AKSVVSHSLTTLGVEVSKpPPQHDKIEASEPSFPLHESILKVVEEEWQQIDRQLPSVACRYPVSSIEAARILSVPKVDDE 80  house mouse
P42166 461 AKTVVSHSLTTLGLEVAK-QSQHDKIDASELSFPFHESILKVIEEEWQQVDRQLPSLACKYPVSSREATQILSVPKVDDE 539 human
2V0X_A  81 ILGFISEATPAAATQASSTESCDKHLDLALCRSYEAAASALQIAAHTAFVAKSLQADISQAAQIINSDPSDAQQALRILN 160 house mouse
P42166 540 ILGFISEATPLGGIQAASTESCNQQLDLALCRAYEAAASALQIATHTAFVAKAMQADISQAAQILSSDPSRTHQALGILS 619 human
2V0X_A 161 RTYDAASYLCDAAFDEVRXSACAXGSSTXGRRYLWLKDCKISPASKNKLTVAPFKGGTLFGGEVHKVIKKRGNK 234 house mouse
P42166 620 KTYDAASYICEAAFDEVKMAAHTMGNATVGRRYLWLKDCKINLASKNKLASTPFKGGTLFGGEVCKVIKKRGNK 693 human
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap