Conserved Protein Domain Family
Inhibitor_Mig-6

?
pfam11555: Inhibitor_Mig-6 
EGFR receptor inhibitor Mig-6
When the kinase domain of EGFR binds to segment one of Mitogen induced gene 6 (Mig-6), EGFR becomes inactive due to the conformation it adopts which is Src/CDK like. The binding of the two proteins prevents EGFR acting as a cyclin-like activator for other kinase domains.The structure of Mig-6(1) consists of alpha helices-G and -H with a polar surface and hydrophobic residues for interactions with EGFR. A critical step for the activation of EGFR is the formation of an asymmetric dimer involving the kinase domains of the protein. Since Mig-6 binds to the kinase domain it blocks this process and EGFR becomes inactive.
Statistics
?
PSSM-Id: 402933
View PSSM: pfam11555
Aligned: 8 rows
Threshold Bit Score: 110.091
Threshold Setting Gi: 928179968
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004567249  883 RPPQIPPRDPLSQPGSRTPSPMG-LV-----VGSPQqrlysvspntmqaaittcPPTHT-----------------YSSY 939  zebra mbuna
XP_023190785  856 RPPQIPPRDPLSQPNSRTPSPNC-AV-----VGSLQqricsv-------spsthQASHS-----------------YSSH 905  southern plat...
XP_013965731  776 SPPRVPPREPLSPQGSRTPSPLV-PP-----GG------------------------SP-----------------LPPR 808  dog
XP_022534393  801 hPPQIPPRDPLSQPGSRTPSPMG-LH-----VGSHCs-----------------PASIY-----------------GSSY 840  Mexican tetra
AWP04485      913 RPPQIPPRDPLSQPGSRTPSPMgllA-----PLTSC------------------PPTHT-----------------YGSY 952  turbot
CAF97625      813 HPPQVPPREPLSQPGSRTPSPRG-LV-----VGS-----------------------PHqrvysvsptaaqaplssYSCY 863  spotted green...
XP_012818066  832 RPPLLPPRDPLSQPTSRTPSPMA-FQ-----VGSPQqrs-------------nlCSPLS-----------------IGTY 875  tropical claw...
XP_021250460  781 RPPQIPPRDPLSQPTSRTPSPMA-LQvgspqQR------------------------AA-----------------LCSC 818  helmeted guin...
XP_004567249  940 LSTSPGKLMPTTHSFASDPKYAAPKVIQAQVQ 971  zebra mbuna
XP_023190785  906 LSTSPGKPMPTTHSFASDPKYAAPKVIQAQGR 937  southern platyfish
XP_013965731  809 LSSSPGKTMPTTQSFASDPKYATPQVIQAPGP 840  dog
XP_022534393  841 LSSSPGKLMPTTQSFASDPKYAAPKVILAQGK 872  Mexican tetra
AWP04485      953 LSTSPGKLMPTTHSFASDPKYAAPKVIQAQGk 984  turbot
CAF97625      864 LSTSPGKLMATTHSFASDPNYAAAKVSQAQGK 895  spotted green pufferfish
XP_012818066  876 LSTSPGKLMPTTQSFASDPKYATPKVIQAQGK 907  tropical clawed frog
XP_021250460  819 LSTSPGKPMPTTQSFALDPKYATPKVIQAQGK 850  helmeted guineafowl
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap