Conserved Protein Domain Family
DUF3231

?
pfam11553: DUF3231 
Protein of unknown function (DUF3231)
This bacterial family of proteins has no known function.
Statistics
?
PSSM-Id: 402931
View PSSM: pfam11553
Aligned: 22 rows
Threshold Bit Score: 173.205
Threshold Setting Gi: 81581781
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q81NQ0                   2 GILSGNPQNEPLHYGEVFDIWSYLLAAQGAIASHQVFMNHTGDEDLKKFLEGLIENdMNSEIEELKTLLKVNGVALPPAP 81  Bacil...
WP_009792121             1 ------mQQERLTSSEISNIWTHYIRETMAVCITKYMLKSIKDKEIYDFLQYALDL-SFQHIDSLTELFKKEKFPIPKGF 73  Bacillus
WP_009794656             1 ----mDKENLKLTSSEIGSLWGEYINGTAVDIVNRYMYSIIEDEEIKSIFNEAIMI-SARQKAQIKAFIENEGFPVPIGF 75  Bacillus
jgi:Amet_4594            3 IGT-----ETKLTASEIAGLWTSYVNDSMGACVLRHFLNNVEDRETKAILKYALSL-SEKHMKKIAEHFNEEKLPIPQGF 76  Alkal...
PRJNA212797:N288_24695   9 aGTNKTSPKEPLTSAEMGKLWATYMGNSMSKGILAYYLHHVDDHDIKALLENASKL-CTEFLTATEGLLKEANFPIPDGF 87  Bacil...
WP_012065382             3 DKA-----KIGLVASEVAGLWDSYVNDSLVICTLSYFIDKTEDEEVLQILQHALDV-SNGHIQVITDIFNQEGLPIPKGF 76  Alkal...
EDK32607                 3 DLK-----NIKLVSSEISGLWDSYMSDSLVICVLKQFLNNVEDNDIQTLLQHTLNL-SIQHISIITDIFNQEGLPIPQGF 76  Clost...
WP_012103183             3 STT-----KTPLVSSEISAIWNSYIGESLVAHIIEYFSSRADDNEIGYMLQHILRL-SNKRIKILTNLFNQEKLPLPEAF 76  Clost...
EDK33108                 3 NIT-----QIPLVSSEITGIWNSYIAESLLACKFQYFLNSVEDVEIKKLLQQNLDL-CNGRIKILSDIFTGEQLPIPDGF 76  Clost...
PRJNA212797:N288_13955   1 --meqIQHQTKMNASEYAVIWSQYINDSLSSCVLQHMLKDAEDKNIREVFEFALEL-SEPHLEKTKKLLKSENQPLPIGF 77  Bacil...
Q81NQ0                  82 PeRPVASIEDIPPgarINDAEIAAAVSTGLAAGLVTCSQVMGKCLREDVGMLFGQFHMKKAQAGVTLLRLSKKKGWVVPP 161 Bacil...
WP_009792121            74 S-KEDVNMDAPAL---FTDAYCLLYMHTMTMHGMQAYGLASSVSIRKDVCDFYGRCNQDTHDLYNKAIELLSEKNLLEKP 149 Bacillus
WP_009794656            76 S-ETDLYPGKQRL---FTDTFCLNYLNIMTTHGLLGHITSLGISVRKDLRLFYGECDEHGKQMYHQTVDLLLEKGLFQRD 151 Bacillus
jgi:Amet_4594           77 T-DSDVNMNAPRL---YTDSFYLFYLRNMGRVGLVAYSMGLGTVGRSDIRDYFTGCLGSSIELLNKVTSLKQSKGIFIRA 152 Alkal...
PRJNA212797:N288_24695  88 N-ENDVNLEAPRL---FHDDFYVHYLKYAAKAGISIYSVGYPIVFRNDIVEFFRYCTQATLDLMDQIKEILMKKGLIIKP 163 Bacil...
WP_012065382            77 T-KDDVNINAPRL---YDDPFYLFYLTNVSQVAMGAYTLILNHVARSDVRNFFSDCISESVELYNKVSDVLLSQGIFIRA 152 Alkal...
EDK32607                77 T-DKDVNINSPRL---FSDTFYAAYISFIARVGMHDYTLTLNQIARSDIRKYFSKCITEYIGLYNKAAELRLSKGIFIRA 152 Clost...
WP_012103183            77 T-DSDVDVNAPRL---FTDILYLQYAAYEARASVRSYSVILSRVTRSDIREYFSKCIEESIDVYNRTAELGLSKGIFIKA 152 Clost...
EDK33108                77 N-EKDVTINAPRL---FTDNFYLQYLCYVSKVGMQNYTSTLNEIARNDIRDYFSKCTLDYVDLYNKSTELKLSKGIFIRT 152 Clost...
PRJNA212797:N288_13955  78 S-EEDVNADAPGL---FTDAFKIVYLHIMALHGLTRYAGATSVCSRKDIRQYFMQCTSEALELYDRTTEVALQKGIIDKA 153 Bacil...
Q81NQ0                 162 PLHVRN 167 Bacillus anthracis
WP_009792121           150 PLYATP 155 Bacillus
WP_009794656           152 PLFYPE 157 Bacillus
jgi:Amet_4594          153 PRVAVP 158 Alkaliphilus metalliredigens QYMF
PRJNA212797:N288_24695 164 PFIPVP 169 Bacillus infantis NRRL B-14911
WP_012065382           153 PKVEFS 158 Alkaliphilus metalliredigens
EDK32607               153 PHIEVP 158 Clostridium kluyveri DSM 555
WP_012103183           153 PQVEVS 158 Clostridium kluyveri
EDK33108               153 PHVEVP 158 Clostridium kluyveri DSM 555
PRJNA212797:N288_13955 154 PTLHNK 159 Bacillus infantis NRRL B-14911
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap