2QWU,2QWU


Conserved Protein Domain Family
IglC

?
pfam11550: IglC 
Click on image for an interactive view with Cn3D
Intracellular growth locus C protein
IglC protein is involved in the escape of F.tularensis live vaccine strain. It has been shown that the expression of IglC is essential for F.tularensis to induce macrophage apoptosis. IglC adopts a beta-sandwich conformation that has no similarity to any known protein structure.
Statistics
?
PSSM-Id: 402929
View PSSM: pfam11550
Aligned: 2 rows
Threshold Bit Score: 402.986
Threshold Setting Gi: 158430481
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QWU_A   2 IXSEXITRQQVTSGETIHVRTDPTACIGSHPNCRXFIDSLTIAGEKLDKNIVAIDGGEDVTKADSATAAASVIRXSITPG 81  Francisella tularensi...
2QWU_A   2 IXSEXITRQQVTSGETIHVRTDPTACIGSHPNCRXFIDSLTIAGEKLDKNIVAIDGGEDVTKADSATAAASVIRXSITPG 81  Francisella tularensi...
2QWU_A  82 SINPTISITLGVLIKSNVRTKIEEKVSSILQASATDXKIKLGNSNKKQEYKTDEAWGIXIDLSNLELYPISAKAFSISIE 161 Francisella tularensi...
2QWU_A  82 SINPTISITLGVLIKSNVRTKIEEKVSSILQASATDXKIKLGNSNKKQEYKTDEAWGIXIDLSNLELYPISAKAFSISIE 161 Francisella tularensi...
2QWU_A 162 PTELXGVSKDGXRYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAAA 211 Francisella tularensis subsp. tularensis
2QWU_A 162 PTELXGVSKDGXRYHIISIDGLTTSQGSLPVCCAASTDKGVAKIGYIAAA 211 Francisella tularensis subsp. tularensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap