Conserved Protein Domain Family
CompInhib_SCIN

?
pfam11546: CompInhib_SCIN 
Staphylococcal complement inhibitor SCIN
SCIN is released by Staphylococcus aureus to counteract the host immune defense. The protein binds to and inhibits C3 convertases on the bacterial surface, reducing phagocytosis and blocking downstream effector functions by C3b deposition on its surface. An 18 residue stretch 31-48 is crucial for SCIN activity.
Statistics
?
PSSM-Id: 371594
View PSSM: pfam11546
Aligned: 3 rows
Threshold Bit Score: 140.877
Threshold Setting Gi: 122540327
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q2FZB7   1 MKFKKYILTGTLALLLSSTGIATIEGNKADASSLDKylTESQFHDKRIAEELRTLLNKSNVYALAAGSLNPYYKRTIMMN 80  Staphylococcus aureus...
Q2FWV6   1 MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLP--TSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKIS 78  Staphylococcus aureus...
Q2G1D4   5 MKIKTYLVAGIKAALLDTTGIKLASKSET---------TSHTYQHQALVDQLHELIANTDLNKLSYLNLDAFQKRDILAA 75  Staphylococcus aureus...
Q2FZB7  81 EYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR 116 Staphylococcus aureus subsp. aureus NCTC 8325
Q2FWV6  79 GLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKS 114 Staphylococcus aureus subsp. aureus NCTC 8325
Q2G1D4  76 HYIAKSAIRTKNLDQMTKAKQRLESIYNSISNPLHS 111 Staphylococcus aureus subsp. aureus NCTC 8325
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap