4FBD


Conserved Protein Domain Family
DUF3228

?
pfam11539: DUF3228 
Protein of unknown function (DUF3228)
This family of proteins has no known function.
Statistics
?
PSSM-Id: 402921
View PSSM: pfam11539
Aligned: 19 rows
Threshold Bit Score: 274.955
Threshold Setting Gi: 81796356
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4FBD_A        40 LDPFCYRQFddpaygGS----RISgVTKEEFLEKVNE-LVtRDagIEF--FQGYAPFCRHLY-IPNFVGALPGSLPITAD 111
A0BP38         8 LDPFCYRQF------GTqgsqQIL-YDREKFVEKVNE-LY-RK--EDL--KDGYAPFCKHIF-IENFTETPNYILKITQE 73  Paramecium tetr...
XP_001748351  10 LDAFAMRQFtdptyqGT----RLK-CSPEEFARQVNE----RCglQDL--KDGYAPFCKHVF-VENFVGASCPVVELNAE 77  Monosiga brevic...
XP_001317605   5 LDEFCYRHWdnpkyhGA----RITtMTKDEFIEHVRKyIA-ENggFDKcsVEGYAPFCRHIF-IPNPTDACVDAVKITPE 78  Trichomonas vag...
Q8PCH7        25 LTPFARPRLfprdgrRN----AIQdCTPEQFIQRLNDe-------TPVrvIEGYAPFCR-LHaHRNWTSTRCLTVPITDA 92  Xanthomonas cam...
ESS33062     262 LDPFCYRQFddpaygGS----RISgVTKEEFLEKVNElVT-RDagIEF--FQGYAPFCRHLY-IPNFVGALPGSLPITAD 333 Toxoplasma gond...
XP_002141864  13 LDSFAFRQFeyg-ycGS----YIPnYTPKQFLAEINK-FI-QLeyPEL--VSGYAPFCKHLF-VPNFTQAKVSVIEITPE 82  Cryptosporidium...
Q4UBA8        26 LDPFCFKQFdkk------ginYIP-YPKESFIEKVRH-SV-RNgsV-L--RDGYAPFCKHLI-LKNFTDATCGFLEITDK 92  Theileria annulata
XP_001611302  12 LEPYCYKQFdqk------qdnYIP-CTKETFLKELVS-RL-KRgeAKL--TDGYAPFCKHLF-VENFTDVTAGYLPITNE 79  Babesia bovis T2Bo
Q231M6         8 IDPFCLKQFdpnvktST----YVC-STVEEMQEHLNK-IY-DP--SKL--VDGYAPFCKHLF-IPNFTQTKLSTSKITPE 75  Tetrahymena the...
4FBD_A       112 NEHLL-RSGYIARRPNELPVLTRWFPMSYAk---dALMPAAFLDLILYSREQIAKETAAESNT------AVVIDPNAPaW 181
A0BP38        74 NEYLI-KTAYKARNERELPVLTRFIPAGSI-----ELQKAKFLDIILYSKEQITKENKSQGVE------DIHGQIDYD-F 140 Paramecium tetr...
XP_001748351  78 TEQLV-TSAYKARTEKELPVLTRWIPADRI-----QAPQAKYLDVILYSREQIIDEHNAMKD-------ENVDIPDSP-W 143 Monosiga brevic...
XP_001317605  79 IEPLI-KSGYCARRDDELPVLCRWVCAQDIp---gGIPKANVLDLIFYNHEQLVAEAKDMN--------LQLQPGDWD-W 145 Trichomonas vag...
Q8PCH7        93 NRHQL-RSGYEARNSQELPVLVRWFEGV-------EPPLATYLLPILYSRDQLAKEGSPI---------------DAD-W 148 Xanthomonas cam...
ESS33062     334 NEHLL-RSGYIARRPNELPVLTRWFPMSYAk---dALMPAAFLDLILYSREQIAKETAAESNT------AVVIDPNAPaW 403 Toxoplasma gond...
XP_002141864  83 NERYL-KTGYISRRKEELPVLSRWFPSDCKfikdsINLPAKYLDIILYSREQCEKEIQGMNLQgkherlVEGSNSDPD-W 160 Cryptosporidium...
Q4UBA8        93 NSSLL-RSGYVSRTANEVPVLSRWFSKSDVl---eYVKRAEYLDVILYSREQVIKEYKAMQTY------EDDSKFLHD-Y 161 Theileria annulata
XP_001611302  80 NIHLLsRSGYVARTKTELPVLSRWFPKSTVe---kELVRASYLDVILYSREQVIKENNARN--------EHVPEDDYD-Y 147 Babesia bovis T2Bo
Q231M6        76 NEHLL-KTIYEARTEKELPVLRRYFPVGSV-----PQEVASHLDIILYSKEQIQLENAAMGNV------DPNKDIDYH-W 142 Tetrahymena the...
4FBD_A       182 SIIAVKAQNEKYSLPMAPITMLRNTL-IEEGGSGVALDREAYKASVAYWKTHAIV 235
A0BP38       141 GIISIKPQDENTEIPMLPITSMRNSLgTKEGGSGVEMNREEYLKSVNFWSKHILV 195 Paramecium tetraurelia
XP_001748351 144 GIISVKAQMEPFETPMQPITMMRNALgKDEGGSGVTLDRAKYQESVEYWSRHVPI 198 Monosiga brevicollis MX1
XP_001317605 146 GLISIKGQDKPGEIPMQPITAMRNALgRQYGGSSVPIDEAKYRASAEYWNKYVSV 200 Trichomonas vaginalis G3
Q8PCH7       149 GVVGCLYTAEPDEIPMTPITMLRNALgVQEGGSGVPLDRDAYRRAVAFWDANANW 203 Xanthomonas campestris pv. campestris
ESS33062     404 SIIAVKAQNEKYSLPMAPITMLRNTL-IEEGGSGVALDREAYKASVAYWKTHAIV 457 Toxoplasma gondii VEG
XP_002141864 161 YIISIKLQNEDFETPMEPITMLRNTI-IEEGGSGVPLDREKYLESVNYWKNHAVI 214 Cryptosporidium muris RN66
Q4UBA8       162 YVISIKPQDVDHELPMLPITIMRNAL-IDEGGSGVPIDREKYMESVKYWSKHAVL 215 Theileria annulata
XP_001611302 148 YVVSIKPQNVEHEIPMLPITMFRNTM-ITEGGSGVPLDHEAYLKSVAFWQENAVV 201 Babesia bovis T2Bo
Q231M6       143 GVVSVKPQNLDYEIPMDPITMMRNALgKEEGGSGVPLDRKKYLESVEFWSKNAII 197 Tetrahymena thermophila SB210
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap