Conserved Protein Domain Family
DUF3226

?
pfam11536: DUF3226 
Protein of unknown function (DUF3226)
This archaeal family of proteins has no known function.
Statistics
?
PSSM-Id: 402919
View PSSM: pfam11536
Aligned: 3 rows
Threshold Bit Score: 340.677
Threshold Setting Gi: 74503012
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5JEB1   3 TRLLLLEGRTDVSFFLPLIKELYGFKEAK--CEDLPVLEegpKKKGLSRAICLSKDDTRLVVWHANGKDNLKNALKLIFK 80  Thermococcus kodakare...
Q60274   1 MRILLLEGITDVAFFIPILKKLYGFSEIS--CDGIIRAE---KMGDISKPICLENEDVKLIVFHSGGKSKQKHALTAMLT 75  Methanocaldococcus ja...
Q5JFE4 100 VSVLFVEGKTDSKFFKAVMKKLFDFRESRtaPRNLKFIE---KVFERDNFDLLHKDGKYVAVIPSEGNSGVIRNLGNFLK 176 Thermococcus kodakare...
Q5JEB1  81 AIER-LEDTPAIIGIARDVDTEESILNWAKSTLQSGGFEPDVKDGYLMIN--GIKVIPFGIGEV---DFDARDIDLKK-E 153 Thermococcus kodakare...
Q60274  76 AIKMgYLSNIKILGIARDIDQEHDVKNWTKSIIKNAGFEVKEGDKFLIIEdlNLKIAVLGIANYdedDFNIPSFELKR-E 154 Methanocaldococcus ja...
Q5JFE4 177 AMDV-FGFGVERIGVAIDVDEDREA-AMASITGKLASFSPRKAGDFYLVW--NTFIVPLIIG-L---PFEDELIDWKKpT 248 Thermococcus kodakare...
Q5JEB1 154 LELLMALLAKKESSLSKLEGSISQLRKDLGRKLTPKDIMHLLAIARNYGGDSMSGLYRNFIEKLIReNRELVEEFLNESG 233 Thermococcus kodakare...
Q60274 155 LEAVITDMAKEISIIEKFKNSLESLSNDAERRLKPKDITHVLAIAKNFDGDSMSGLYRKFIEEQIN-NKNKVNFLLTLIC 233 Methanocaldococcus ja...
Q5JFE4 249 VEDLMLHLISAEGLLEKLRPALGAFEESLGRKLKPKEVMYLALSAYGHWGN-LEGFYELFVMRSRHrHIKDVLRKAGLME 327 Thermococcus kodakare...
Q5JEB1 234 LKEFLNaIA 242 Thermococcus kodakarensis KOD1
Q60274 234 ILPCLT-IF 241 Methanocaldococcus jannaschii DSM 2661
Q5JFE4 328 GLRFLAfAE 336 Thermococcus kodakarensis KOD1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap