Conserved Protein Domain Family
Nab2

?
pfam11517: Nab2 
Nuclear abundant poly(A) RNA-bind protein 2 (Nab2)
Nab2 is a yeast heterogeneous nuclear ribonucleoprotein that modulates poly(A) tail length and mRNA. This is the N terminal domain of the protein which mediates interactions with the C-terminal globular domain, Myosin-like protein 1 and the mRNA export factor, Gfd1.The N-terminal domain of Nab2 shows a structure of a helical fold. The N terminal domain of Nab2 is thought to mediate protein protein interactions that facilitate the nuclear export of mRNA. An essential hydrophobic Phe73 patch on the N terminal domain is thought to be a important component of the interface between Nab2 and Mlp1.
Statistics
?
PSSM-Id: 402904
View PSSM: pfam11517
Aligned: 12 rows
Threshold Bit Score: 161.46
Threshold Setting Gi: 74605240
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q75E99           1 MSaiQDDISGSLKTVVAEKLKTLQNFSEDVNYVAEYIVLLLSNGGTHDSVLQELVGLFDSVPQQALADVVQTSFQALQLL 80  Eremothecium ...
CCE93706         1 MS--QEQFTENLKVIVAEKLGTLPNFHEDIKYVAEYIVLLMVNGGTVETVVQELSTLFDSVSPDSLTDVVQTAFFALEAL 78  Torulaspora d...
XP_002556150     1 MSdpKEEIFNNLKVVIAENLKTLPNFNEDVNYVAEYIVLLMSNGGNLESVVQELTSLFDTVPPEAFHNVVQNAYKVLGYL 80  Lachancea the...
ybcl:Ecym_3055   1 MStlQEDVSGSLKTIVAEKLKTLQNFNEDVNYVAEYIVLLLSNGGTHDSVLQELIGLFDSVSQEALAGVVQTSFQALELL 80  Eremothecium ...
Q6CKL1           1 MStvPEYIASNLKTVISERLKVVPNFNEDVNQVAEYITLLMSNGSSGPDIVQELTSLFDGISTQEFQSVVSIAFTSADLL 80  Kluyveromyces...
XP_001645416     1 MS--DNQIIEDMKVIVAEKLSTLQNFSEDVKYVAEYIVLLMSNGGSIESIVQELTTLFDTVSSEALTDVVQTSFFALEAL 78  Vanderwaltozy...
XP_003684367     1 MS--DDKIIENMKVIVAEKLNTLQNFNEDINYVAEYIVLLMSNGGSVESIVQELTTLFDSVSTEVLTDVVQTAFFALEAI 78  Tetrapisispor...
CCD26728         1 MS--QEQYSENLKVIVAEKLNGVENFNEDVKYVAEYIVLLIMNGGTVETVVQELSTLFDTISSVALVNVVQTAFFALEAL 78  Naumovozyma d...
XP_003676270     1 MS--QEQYNESLKTIVAEKLNGIPNFNEDIKYVAEYIVLLISNGGTVEGVVTELSTLFDTLSTETLMDVVQTTFFALEAL 78  Naumovozyma c...
CCF55895         1 MS--EQQYTESLKVIVAEKLKGVENFTEDVNYVAEYIVLLIVNGGTLESIVQELSTLFDAISTDALTNVVQTAFFALEAL 78  Kazachstania ...
CCK70912         1 MS--QEQYTENLKVIVAEQLRGVHNFTEDVNYVAEYIVLLIVNGGDVESIVKELSTLFDAIPVDVLKDIVQTDFFALEAL 78  Kazachstania ...
CCH61798         1 MS--QEQYAENLKVIVSEKLQTLPNFTEDVAYVAEYIVLLIVNGGSIESVVQELSTLFDTVSKDNLTDVVQTTFFALEAL 78  Tetrapisispor...
Q75E99          81 RSGDNIETVYQKLTnpGMMAPE 102 Eremothecium gossypii
CCE93706        79 QQGETVDSIVSKIR--GSGSAP 98  Torulaspora delbrueckii
XP_002556150    81 QGGDSLEVAVSKLT--GGSNAP 100 Lachancea thermotolerans CBS 6340
ybcl:Ecym_3055  81 RSGDNAETVYRKLA--GVIEPV 100 Eremothecium cymbalariae DBVPG#7215
Q6CKL1          81 KAGDDLNTVYAKLS--GNSSQP 100 Kluyveromyces lactis
XP_001645416    79 QQGETVTNIVSKIR--SVAGAS 98  Vanderwaltozyma polyspora DSM 70294
XP_003684367    79 QQGEPVANIVEKIR--GVAQAT 98  Tetrapisispora phaffii CBS 4417
CCD26728        79 QQGEPVENIVNKIR--EMNAAA 98  Naumovozyma dairenensis CBS 421
XP_003676270    79 QQGEPTEVIVAKIR--EMNAAA 98  Naumovozyma castellii CBS 4309
CCF55895        79 QQGETTESIVSKIQ--AMNVQQ 98  Kazachstania africana CBS 2517
CCK70912        79 QQGETVDSIVSKIR--ELNGNN 98  Kazachstania naganishii CBS 8797
CCH61798        79 QQGETVDSIVSKIR--GLSAQQ 98  Tetrapisispora blattae CBS 6284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap