2JPF


Conserved Protein Domain Family
DUF3220

?
pfam11516: DUF3220 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF3120)
This family of proteins with unknown function appears to be restricted to Bordetella.
Statistics
?
PSSM-Id: 151953
View PSSM: pfam11516
Aligned: 3 rows
Threshold Bit Score: 207.369
Threshold Setting Gi: 188595807
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JPF_A  22 KQQLQEHAPSHANLDVKWLDGLRAGSMALQGDVKVWMQNLEDLHTRRPDEFTARLQQSTDALYSHLEAQWAKQHGTPPTA 101
Q7VSD3 115 KQQLHEQAPSHANLDVKWLDGLRAGSMALQGDVKVWMQNLEDLHTRRPDEFAARLQQSTDALYSHLEAQWAKQHGTPPTA 194 Bordetella pertussis
Q7VSD3 115 KQQLHEQAPSHANLDVKWLDGLRAGSMALQGDVKVWMQNLEDLHTRRPDEFAARLQQSTDALYSHLEAQWAKQHGTPPTA 194 Bordetella pertussis
2JPF_A 102 SDVVGMPQWQEYTAMLRERFAGLDTI 127
Q7VSD3 195 SDVAGMPQWQEYTAMLRERFAGLDTI 220 Bordetella pertussis
Q7VSD3 195 SDVAGMPQWQEYTAMLRERFAGLDTI 220 Bordetella pertussis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap